DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and ADAD1

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_640336.1 Gene:ADAD1 / 132612 HGNCID:30713 Length:576 Species:Homo sapiens


Alignment Length:351 Identity:67/351 - (19%)
Similarity:116/351 - (33%) Gaps:120/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NGPPPHFGMMPGGNVRRPE--STDDRHAIARHAEIYPKEEEL--QTIQRIVSHTERALKLVSDAL 532
            :||||    .|...|...|  .....|...||.: |.|..::  :...:::|:....||..|...
Human   176 SGPPP----FPAEPVVLSELAYVSKVHYEGRHIQ-YAKISQIVKERFNQLISNRSEYLKYSSSLA 235

  Fly   533 AEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADNGGN-------VVRILKGVMRVGYLAKG 590
            |.....||      :.|..:...|.    :::.:|....|.       ||...:.::|..| .:.
Human   236 AFIIERAG------QHEVVAIGTGE----YNYSQDIKPDGRVLHDTHAVVTARRSLLRYFY-RQL 289

  Fly   591 LLLHGDN--AVELVVLCAEKPTSGLLQRVANV--------LPDKLKEVAGDTQVNYRVEVNAEEA 645
            ||.:..|  .:|..:.|.| |||.||....|:        ||      .|..|:..::.:|....
Human   290 LLFYSKNPAMMEKSIFCTE-PTSNLLTLKQNINICLYMNQLP------KGSAQIKSQLRLNPHSI 347

  Fly   646 ALIVLDESVSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATG 710
            :....:|.:.:.:.:                 ||:                              
Human   348 SAFEANEELCLHVAV-----------------EGK------------------------------ 365

  Fly   711 LQSCVMVIRILRDLCQRVSSWQS---LPQWS--------LELLVEKVISSAGFPISPGDC----- 759
               ..:.:...:|...|:||..|   |.:|.        |...::.|..|: ..|..|:|     
Human   366 ---IYLTVYCPKDGVNRISSMSSSDKLTRWEVLGVQGALLSHFIQPVYISS-ILIGDGNCSDTRG 426

  Fly   760 -----MRRIMEALSSG----FLINGP 776
                 .:|:.:||:|.    :|:|.|
Human   427 LEIAIKQRVDDALTSKLPMFYLVNRP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 42/235 (18%)
ADAD1NP_640336.1 DSRM 97..162 CDD:214634
A_deamin 249..568 CDD:307992 47/267 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.