DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS9 and SYC1

DIOPT Version :9

Sequence 1:NP_648838.3 Gene:IntS9 / 39763 FlyBaseID:FBgn0036570 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_014822.1 Gene:SYC1 / 854351 SGDID:S000005705 Length:188 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:19/115 - (16%)
Similarity:34/115 - (29%) Gaps:46/115 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 DLFECLTQN---LENAGLNNVPMFFISPVADSSLAYSNILAEW--------------------LS 347
            ||:..:.|.   :|.....|.....:....:..::.|::..||                    |.
Yeast    27 DLYLHIVQTFGCIETTATENATKLLMLGDVEVEISASSVSIEWTQKSMISQTIADSIVIMIIGLC 91

  Fly   348 SAKQNKVYLPDDPFPHAFYLRNNKLKHYNH----------VFSEGFSKDF 387
            ::.:|             .|..::||..||          :|.|.|...|
Yeast    92 ASDKN-------------VLSESELKERNHNVWKIQELQNLFREQFGDSF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS9NP_648838.3 metallo-hydrolase-like_MBL-fold 1..264 CDD:304873
Beta-Casp 304..428 CDD:214983 19/115 (17%)
SYC1NP_014822.1 CPSF73-100_C <28..186 CDD:416974 18/114 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.