DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS9 and dclre1a

DIOPT Version :9

Sequence 1:NP_648838.3 Gene:IntS9 / 39763 FlyBaseID:FBgn0036570 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001018385.4 Gene:dclre1a / 324964 ZFINID:ZDB-GENE-050522-124 Length:926 Species:Danio rerio


Alignment Length:317 Identity:63/317 - (19%)
Similarity:108/317 - (34%) Gaps:112/317 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYC--LSGDLAK-----------------PCYIITFKGLRI-MLDCGLTEQTVLNFLPLPFVQSL 47
            :||  ::.:|.|                 .|.:   :|::: :||........:....||..|::
Zfish   618 IYCNKVTSNLVKSKLKVDEQYIHVLPMNTECIV---QGVKVTLLDANHCPGAAMLLFVLPDGQTV 679

  Fly    48 KWSNLPNFVPSRDHDPQMDGELKDCCGRVFVDST---PEFNLPMDKMLDFSEVDVILISNYLNML 109
            ..:......||.:..|::.| |:  ...:::|:|   ||:..|       ::.:|:..:      
Zfish   680 LHTGDFRADPSMERYPELQG-LR--IQTLYLDTTYCSPEYTFP-------TQQEVVTFA------ 728

  Fly   110 ALPYITENTGFKGKVYATEPTLQIGRFFLEELVDYIEVSPKAC-TARLWKEKLHLLPSPLSEAFR 173
                  .||.|: :|.....||.:                  | |..:.|||:.|   .:||...
Zfish   729 ------VNTAFE-RVTLNPRTLVV------------------CGTYSVGKEKVFL---AVSEVLS 765

  Fly   174 AK------KWRTIFSLKDVQGSLSKVTIMGYDEKLDILGAFIATPVSSGYCLGSSNWVLSTAHEK 232
            :|      |:.|:..|                |..|| |..|.|           ||..:..|..
Zfish   766 SKVCLSKDKYNTMCCL----------------ESEDI-GQRITT-----------NWQSAQVHVL 802

  Fly   233 ICYVSGSSTLTTHPRPINQSALKHADVLIM---TGLTQAPTVNPDTKLGELCMNVAL 286
            .........|.||.:..:    |..|.|:.   ||.|...||..|..|.:...|:::
Zfish   803 PMMQINFKNLQTHLKKFS----KKYDQLVAFKPTGWTFNQTVGVDDILPQTQGNISI 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS9NP_648838.3 metallo-hydrolase-like_MBL-fold 1..264 CDD:304873 55/293 (19%)
Beta-Casp 304..428 CDD:214983
dclre1aNP_001018385.4 SNM1A-like_MBL-fold 558..714 CDD:293856 18/101 (18%)
DRMBL 785..888 CDD:284854 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.