Sequence 1: | NP_648838.3 | Gene: | IntS9 / 39763 | FlyBaseID: | FBgn0036570 | Length: | 654 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099671.1 | Gene: | Dclre1a / 292127 | RGDID: | 1306156 | Length: | 1026 | Species: | Rattus norvegicus |
Alignment Length: | 322 | Identity: | 63/322 - (19%) |
---|---|---|---|
Similarity: | 104/322 - (32%) | Gaps: | 111/322 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 364 AFYLRNNKLKHYNHVFSEGFSKDFRQPCVVFCGH-------PSLR---------------FGDAV 406
Fly 407 HFIEMWGNN-----------PNNSIIFTEPDF---PYLQ--VLA--PFQPLAMKAFYC-PIDTSL 452
Fly 453 NYQQA-----NKLIK--ELKPNVLVIPEAY----------------------TKPHPSAPNLFIE 488
Fly 489 QPDKKIITFKCGEIIRL-------------PLKR---KLDRIY------------ITS--ELAQK 523
Fly 524 ISPKEVAAGVTFSTLTGVLQVKDKVHCIQP--CADSVKDETISSNSAPTKEDVLKNVKYEYG 583 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
IntS9 | NP_648838.3 | metallo-hydrolase-like_MBL-fold | 1..264 | CDD:304873 | |
Beta-Casp | 304..428 | CDD:214983 | 20/99 (20%) | ||
Dclre1a | NP_001099671.1 | Ustilago_mating | <7..115 | CDD:114448 | |
metallo-hydrolase-like_MBL-fold | 675..830 | CDD:304873 | 26/123 (21%) | ||
DRMBL | 900..1005 | CDD:284854 | 19/104 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1236 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |