DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS9 and Dclre1a

DIOPT Version :9

Sequence 1:NP_648838.3 Gene:IntS9 / 39763 FlyBaseID:FBgn0036570 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001099671.1 Gene:Dclre1a / 292127 RGDID:1306156 Length:1026 Species:Rattus norvegicus


Alignment Length:322 Identity:63/322 - (19%)
Similarity:104/322 - (32%) Gaps:111/322 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 AFYLRNNKLKHYNHVFSEGFSKDFRQPCVVFCGH-------PSLR---------------FGDAV 406
            |::|.:....||     .|.||||.:|  ::|..       ..||               ..|.|
  Rat   713 AYFLTHFHSDHY-----AGLSKDFTRP--IYCSEITGSLLKKKLRVQEQYIHQLPMDTECIVDGV 770

  Fly   407 HFIEMWGNN-----------PNNSIIFTEPDF---PYLQ--VLA--PFQPLAMKAFYC-PIDTSL 452
            ..:.:..|:           ||.::.....||   |.::  :||  ....|.:...|| |..|..
  Rat   771 KVVLLDANHCPGATMILFQLPNGAVTLHTGDFRADPSMERSLLASRKVHTLFLDTTYCSPEYTFP 835

  Fly   453 NYQQA-----NKLIK--ELKPNVLVIPEAY----------------------TKPHPSAPNLFIE 488
            :.|:|     |...:  .|.|..|::...|                      .:.:.:...|.|.
  Rat   836 SQQEAIQFAINTAFEAVTLNPRALIVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP 900

  Fly   489 QPDKKIITFKCGEIIRL-------------PLKR---KLDRIY------------ITS--ELAQK 523
            :....|.|..|..::.|             .||:   |.|:|.            |||  ::..:
  Rat   901 EVSSLITTDMCNSLVHLLPMMQINFKGLQNHLKKCGGKFDQILAFRPTGWTHSNNITSIADITPQ 965

  Fly   524 ISPKEVAAGVTFSTLTGVLQVKDKVHCIQP--CADSVKDETISSNSAPTKEDVLKNVKYEYG 583
            ........|:.:|..:..|::|..|..::|  ...:|...|..|.:  |.|...|..:.|.|
  Rat   966 TKGNIAIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTFQSRN--TMEKYFKEWRLEAG 1025

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS9NP_648838.3 metallo-hydrolase-like_MBL-fold 1..264 CDD:304873
Beta-Casp 304..428 CDD:214983 20/99 (20%)
Dclre1aNP_001099671.1 Ustilago_mating <7..115 CDD:114448
metallo-hydrolase-like_MBL-fold 675..830 CDD:304873 26/123 (21%)
DRMBL 900..1005 CDD:284854 19/104 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.