DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS9 and cpsf-3

DIOPT Version :10

Sequence 1:NP_648838.3 Gene:IntS9 / 39763 FlyBaseID:FBgn0036570 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_502553.2 Gene:cpsf-3 / 178285 WormBaseID:WBGene00013460 Length:707 Species:Caenorhabditis elegans


Alignment Length:46 Identity:11/46 - (23%)
Similarity:19/46 - (41%) Gaps:10/46 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VVLPISQPNR----------FCNSAMSSFFPLPTSSSNESTRKKPY 70
            :|.|:...:|          ||.....:.:....||||:.:..||:
 Worm    75 IVSPLVVADRGLELLSATFIFCVLVTLALYVTGRSSSNKGSSLKPH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS9NP_648838.3 metallo-hydrolase-like_MBL-fold 1..264 CDD:451500 11/46 (24%)
Beta-Casp 304..428 CDD:214983
cpsf-3NP_502553.2 CPSF3-like_MBL-fold 11..206 CDD:293850 11/46 (24%)
YSH1 13..421 CDD:440849 11/46 (24%)
CPSF73-100_C 477..694 CDD:215023
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.