DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IleRS-m and MetRS-m

DIOPT Version :9

Sequence 1:NP_648837.2 Gene:IleRS-m / 39762 FlyBaseID:FBgn0036569 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001262564.1 Gene:MetRS-m / 41733 FlyBaseID:FBgn0027083 Length:582 Species:Drosophila melanogaster


Alignment Length:458 Identity:94/458 - (20%)
Similarity:155/458 - (33%) Gaps:155/458 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 DSKGTGLVHTAPAHGPEDFLVSLTQKIPVKCFVNEEGTYTKEA--------PDFLRGK------- 397
            |..||.:...|..||           :||..:.::.....:|.        .||:|..       
  Fly    67 DEHGTKIQQAASLHG-----------VPVAKYCDDISQRYREVFRSASIQQDDFIRTTEDRHKRA 120

  Fly   398 ---------------SVLDQGNSLVLD---------RIAEDVVHSSKLEHSYPIDWRTKKPVIIR 438
                           |....|...|.|         |:.|.......||..:|::|..:...:.|
  Fly   121 VANFWRTLHTRGHIYSAAYSGWYCVSDETFLTDSQLRLDEATGTRYSLESGHPVEWTEETNYMFR 185

  Fly   439 ASE------QWFINTEKLKTPAADALEQVEIYPRANAEASKKALLTQLQK--------RPYWCIS 489
            .|:      .| :.||....||                ..:|.||..|.:        ||    |
  Fly   186 LSQFQDDVRHW-VKTEARVRPA----------------KFEKILLDTLSEPLPDVSVSRP----S 229

  Fly   490 RQRAWGVPIPVLYSRESGKV-VLNSALIEHLCNLLRKEGSIDFWWVKSVEELVPEHLLRELHHEA 553
            .:..|.:|:|   ..:|..| |...||:.:|.::...:......|..:.:               
  Fly   230 NRVHWAIPVP---DDDSQTVYVWLDALVNYLSSVGYPDEKFSAHWPPAQQ--------------- 276

  Fly   554 KDLVKGTDILDIWFDSGSTWSAVLGKDKIADLYLEGYDQFTGWFQSSLLMSIAARECAPYKALFV 618
                                  |:|||.:         :|.|.:.::.|:   |....|...|:|
  Fly   277 ----------------------VIGKDIL---------KFHGIYWTAFLL---AAGLEPPGQLYV 307

  Fly   619 HG-FTVDEKGYKMSKSLGNVISPKQITKKYGTDALRWWVASHGTQH----MSITVSDKLL-QQAA 677
            |. :|||  |.|||||..||:.|.|..::|..:.||:::...|..|    .|...:.::| .:.|
  Fly   308 HSHWTVD--GQKMSKSKHNVVDPLQAAQQYTMEGLRYFLLREGVAHSDGNYSHVKAQRILNSELA 370

  Fly   678 ENLCKI--RGTMRYLK-GVIGEKQSGE---KLIRTSDKSYLNRYLLSQLVEFESEVEKLYQAYEY 736
            :.|..:  |.:.:.|. |.|....|.|   .|:|:.|   :.:.|...|::.....|..|:...:
  Fly   371 DTLGNLLSRASAKSLNPGQIYPSPSAEHLADLLRSLD---VAKRLQDSLLQLSERCESHYECNHF 432

  Fly   737 NRV 739
            :.|
  Fly   433 HLV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IleRS-mNP_648837.2 ileS 26..938 CDD:235588 94/458 (21%)
nt_trans 75..>211 CDD:294020
nt_trans <434..658 CDD:294020 52/239 (22%)
Anticodon_Ia_Ile_BEm 668..842 CDD:153414 17/79 (22%)
MetRS-mNP_001262564.1 MetRS_core 20..356 CDD:173907 76/374 (20%)
PRK11893 21..553 CDD:237012 94/458 (21%)
Anticodon_Ia_like 365..503 CDD:299868 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.