DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbetaL and kdm5c

DIOPT Version :9

Sequence 1:NP_648836.2 Gene:ATPsynbetaL / 39761 FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001116706.1 Gene:kdm5c / 553406 ZFINID:ZDB-GENE-060810-94 Length:1578 Species:Danio rerio


Alignment Length:155 Identity:37/155 - (23%)
Similarity:51/155 - (32%) Gaps:52/155 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KDKKKSGDECEPEPQEVCKTDAELV-KKKDEAEDECEEKKSDGGGKKLESK-------------- 100
            :|:..|..|.|||.::....||.:| ...:||||...:...||...|...:              
Zfish  1376 EDEMVSIKEEEPEEKKKWNGDAVIVLSDSEEAEDGVIDLTEDGNSPKKNERNAVNGTQSGCENGI 1440

  Fly   101 GRKGVIHAVIGPVIDVYFEEEVPEVLNALQVQDAPIANLVLEVFHHLGNNIVRC----------- 154
            |||...|.|.|          |..:|:.:.....|:..|         |..||.           
Zfish  1441 GRKSSAHEVTG----------VESLLSLVPSLKGPVVEL---------NTSVRAQLEELQLEGDL 1486

  Fly   155 --VAMDSTEGLRR-----GQPVLDT 172
              |.:|.|..:.|     .||..||
Zfish  1487 LEVTLDQTHAIYRILQASSQPPQDT 1511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 19/88 (22%)
ATP-synt_ab_N 106..173 CDD:280947 18/85 (21%)
F1-ATPase_beta 175..454 CDD:238553
ATP-synt_ab_C 462..571 CDD:278722
kdm5cNP_001116706.1 JmjN 13..54 CDD:128818
BRIGHT 80..170 CDD:128777
PHD1_KDM5C_5D 360..405 CDD:277077
JmjC 535..651 CDD:202224
zf-C5HC2 741..793 CDD:280996
PLU-1 806..1134 CDD:285609
PHD2_KDM5C_5D 1254..1311 CDD:277081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.