DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbetaL and Kdm6b

DIOPT Version :9

Sequence 1:NP_648836.2 Gene:ATPsynbetaL / 39761 FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_038942397.1 Gene:Kdm6b / 363630 RGDID:1307629 Length:1636 Species:Rattus norvegicus


Alignment Length:180 Identity:38/180 - (21%)
Similarity:58/180 - (32%) Gaps:57/180 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSWAKMATACARIGLKMGPGTG--------GYRGNYLGNPVVFPRYLHASLSLWD--------DK 51
            |.|.:....|..|...:||.|.        .|..|.:.|.......:|.|   |:        |.
  Rat  1462 VHWVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEVKNVKSIVPMIHVS---WNVARTVKISDP 1523

  Fly    52 DKKKSGDECEPEPQEVCKTDAELV----KK-------KDEAEDECEE----------KKSDGGGK 95
            |..|....|..:..:.|:...|.:    ||       |||....|.|          ..|:.|.:
  Rat  1524 DLFKMIKFCLLQSMKHCQVQRESLVRAGKKIAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSR 1588

  Fly    96 -----------KLESKGRKGVIHAVIGPVIDVYFEEEVPEVLNALQVQDA 134
                       :..|.|.:||:      |::.|..||:.:..:|..:..|
  Rat  1589 NTYLVHCEGCARRRSAGLQGVV------VLEQYRTEELAQAYDAFTLAPA 1632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 8/32 (25%)
ATP-synt_ab_N 106..173 CDD:280947 6/29 (21%)
F1-ATPase_beta 175..454 CDD:238553
ATP-synt_ab_C 462..571 CDD:278722
Kdm6bXP_038942397.1 TPR repeat 106..136 CDD:276809
JmjC 1336..1400 CDD:214721
JmjC 1370..1478 CDD:396791 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.