DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbetaL and lid

DIOPT Version :9

Sequence 1:NP_648836.2 Gene:ATPsynbetaL / 39761 FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001245908.1 Gene:lid / 33837 FlyBaseID:FBgn0031759 Length:1838 Species:Drosophila melanogaster


Alignment Length:257 Identity:46/257 - (17%)
Similarity:88/257 - (34%) Gaps:70/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 GTDMGTMQERITSTRNGSITSVQAVYVPADDLSDPAPAATFSHLDATTVLSRPIAELGIYPAVDP 444
            |..:|.:.......|.||:|.             .|..:|.|..|...               |.
  Fly  1425 GAGVGNISSPRKPRRRGSLTK-------------EASGSTESDADDDD---------------DE 1461

  Fly   445 LDSSSRILDPDVVGEEHYNVARAVQKTLQAYKSLQDIIAILG-------MDELSEEDKLTVARAR 502
            .:...||::.:...:|..........|:.:     |::.:|.       :|.:.|.|.|.|:   
  Fly  1462 DECRLRIVEDNFSNDEDEPRTAPATSTVNS-----DLLKLLSDSEIENLLDLMMEGDLLEVS--- 1518

  Fly   503 KMQRFLSQPFQVAEIFTGHPGKLV---PVEKCVEGFKRLLNGEYDDIPEIAFYMVGDAEE----V 560
                 |.:..::..|....|..|:   .:|:.|:..:|......:.:|      ...||:    :
  Fly  1519 -----LDETQELWRILETMPPTLLQAEAMERVVQYMQRQRQQHTNPLP------TSGAEDSNDSL 1572

  Fly   561 LAKATQLAASMSGDAPPAKAEAKKDEKKDTKPEEGKKEEPPKGEDKKEEAKDDKPKE-PEKK 621
            :.:.:..:.|.||.|..:.:.:.:::|:.:....|....|.|        |...||: |.||
  Fly  1573 MVQNSPNSNSNSGGATGSASNSGRNKKRRSNDTGGNSAVPRK--------KQSTPKQTPGKK 1626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 32/201 (16%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553 13/73 (18%)
ATP-synt_ab_C 462..571 CDD:278722 18/122 (15%)
lidNP_001245908.1 JmjN 160..201 CDD:128818
ARID 227..312 CDD:198082
PHD1_Lid_like 450..495 CDD:277078
JmjC 624..740 CDD:202224
zf-C5HC2 830..882 CDD:280996
PLU-1 896..1229 CDD:285609
PHD2_KDM5A 1295..1351 CDD:277079
PHD3_KDM5A_like 1755..1805 CDD:277083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.