DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynbetaL and KDM6B

DIOPT Version :9

Sequence 1:NP_648836.2 Gene:ATPsynbetaL / 39761 FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001073893.1 Gene:KDM6B / 23135 HGNCID:29012 Length:1682 Species:Homo sapiens


Alignment Length:174 Identity:37/174 - (21%)
Similarity:56/174 - (32%) Gaps:57/174 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSWAKMATACARIGLKMGPGTG--------GYRGNYLGNPVVFPRYLHASLSLWD--------DK 51
            |.|.:....|..|...:||.|.        .|..|.:.|.......:|.|   |:        |.
Human  1469 VHWVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEVKNVKSIVPMIHVS---WNVARTVKISDP 1530

  Fly    52 DKKKSGDECEPEPQEVCKTDAELV----KK-------KDEAEDECEE----------KKSDGGGK 95
            |..|....|..:..:.|:...|.:    ||       |||....|.|          ..|:.|.:
Human  1531 DLFKMIKFCLLQSMKHCQVQRESLVRAGKKIAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSR 1595

  Fly    96 -----------KLESKGRKGVIHAVIGPVIDVYFEEEVPEVLNA 128
                       :..|.|.:||:      |::.|..||:.:..:|
Human  1596 NTYLVHCEGCARRRSAGLQGVV------VLEQYRTEELAQAYDA 1633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 7/26 (27%)
ATP-synt_ab_N 106..173 CDD:280947 5/23 (22%)
F1-ATPase_beta 175..454 CDD:238553
ATP-synt_ab_C 462..571 CDD:278722
KDM6BNP_001073893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..88
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..680
Mito_fiss_reg <566..640 CDD:283069
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..1096
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1325
JmjC 1343..1407 CDD:214721
JmjC 1377..1485 CDD:202224 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.