DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13074 and LOC798868

DIOPT Version :9

Sequence 1:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_021326617.1 Gene:LOC798868 / 798868 -ID:- Length:608 Species:Danio rerio


Alignment Length:315 Identity:59/315 - (18%)
Similarity:108/315 - (34%) Gaps:100/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SQDAATG------TQEKLHVATQTEQRVVSSKDVEYDERALAKWLRQICPMVERELMNPTPLME- 96
            |:|...|      .:||..|....|..:...:.:...|||||:..........|:|.:....|: 
Zfish   168 SKDTKEGHPRELTEEEKQQVLHSEEFLIFFDRSIRVMERALAEDSNIFFDYSGRDLEDKEGDMQG 232

  Fly    97 --DLTMSQCRLEE---KLQVYT-------YQKLIMGGAENSQGLAIWLCVHTNNAPVLVATTVAP 149
              .|::|:...:|   |.:|.|       |.:|::....|::.                    ||
Zfish   233 GSSLSLSRLFYDEHWSKHRVITCLDWSPQYPELLVASYNNNED--------------------AP 277

  Fly   150 HDD------WCEHVDQQLKLFVPQRMSVGNLVIYTEAKTLPLKSCLRSLCTNP--------FNKT 200
            |:.      |    :.:.|...|:       .||.              |.:|        |:..
Zfish   278 HEPDGVALVW----NMKFKKTTPE-------YIYH--------------CQSPVVSVGFALFHPN 317

  Fly   201 MFAGSTMDGELFIWLYEQARGS-------DSSVDIKQLYSVS--STQGAAVALDWPREHLLLACF 256
            :..|.|..|::.:|.....|.:       .::.....:|.|:  .||.|         :.|:...
Zfish   318 LLVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNA---------NNLITVS 373

  Fly   257 ANGSVRQWDLSR----QMALDWEYTLPATVSSEPTAMVTLGLDDFVVGTNDGGVY 307
            .:|.:..|.|..    |.:::..|.....|:....|..|..:::::||:.:|.||
Zfish   374 TDGRMCSWSLDMLSQPQESMELVYNKSKPVAVTGMAFPTGDVNNYIVGSEEGTVY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 9/59 (15%)
WD40 repeat 242..275 CDD:293791 5/36 (14%)
LOC798868XP_021326617.1 Dynein_IC2 109..135 CDD:314442
WD40 246..569 CDD:330360 41/237 (17%)
WD40 repeat 253..302 CDD:293791 12/93 (13%)
WD40 repeat 308..346 CDD:293791 6/37 (16%)
WD40 repeat 355..398 CDD:293791 10/51 (20%)
WD40 repeat 406..452 CDD:293791 7/23 (30%)
WD40 repeat 459..492 CDD:293791
WD40 repeat 498..539 CDD:293791
WD40 repeat 544..568 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453532at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.