DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13074 and dync2i2

DIOPT Version :9

Sequence 1:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001099160.1 Gene:dync2i2 / 794361 ZFINID:ZDB-GENE-070928-9 Length:501 Species:Danio rerio


Alignment Length:396 Identity:82/396 - (20%)
Similarity:140/396 - (35%) Gaps:112/396 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSQDAATGTQEK--LHVATQTE----QRVVSSKDVEYDERALAKWLRQICPMVERELMNPTPL-- 94
            |.....|.||.|  ....|||:    |.:...:|:. |...|..::|:...:|.|||:..:..  
Zfish    33 PVHTTETETQAKDVSENGTQTQDQSGQTLSLDRDLT-DFPGLLDFMRRAEDVVIRELVKNSKSHA 96

  Fly    95 ----------MEDLTMSQCRL------EEKLQVYTYQKLIMGGAENSQGLAIWLCVHTNNAPVLV 143
                      ..:......||      |:.|||.:..               |.|..:     ::
Zfish    97 FDGFEVNWEEQNESVSCMYRLQHVDAQEKSLQVTSVS---------------WNCTGS-----VI 141

  Fly   144 ATTVAPHD--DWCE--------HVDQQLKLFVPQRMSVGNLVIYTEAKTLPLKSCLRSLCTNPFN 198
            |......|  ||..        :||:|  ...|:|..|          .:.:.:.:..||.:|..
Zfish   142 ACGFGRVDDGDWSNEKACVCTWNVDRQ--NLNPKRPDV----------IIDVATPVMCLCFHPVR 194

  Fly   199 KTMFAGSTMDGELFIWLYEQARGSD-------SSVDI--KQLYSVSSTQGAAVALDWPREHLLLA 254
            .::.||....||:.:|  :.:|..|       .|.|.  :.:|.::...||...     |..:|:
Zfish   195 PSVVAGGLYSGEVVVW--DTSRSQDLILAQTGMSADTHREPVYQINWVPGARRG-----EFSVLS 252

  Fly   255 CFANGSVRQWDL---SRQMALDWEYTL------PATVSSEPTAMVTLG----------LDDFVVG 300
            ..:.|.|..|.:   ..::.|...|.|      .:..:|:....:|:|          ||.|:||
Zfish   253 AGSGGRVLLWTIDGSEAKLLLSSGYALVRQQMPQSGAASKTRGSLTIGVTAVALSPWDLDTFLVG 317

  Fly   301 TNDGGVYRCWNTGRQTAAI----KQIKLLALRRHRFM-----VSTLLRTEMEGNLFVLSCDLSGQ 356
            :..|.|.:|..:....||:    :.:.|.|..:..|.     :.::..:....|||| |....|.
Zfish   318 SEGGLVLKCSFSSETAAAVPSDGESVILRAPMQFSFSPRGGPIHSVHFSPFHRNLFV-SVGTDGL 381

  Fly   357 AFYHDM 362
            |..|.:
Zfish   382 AHLHSV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 13/53 (25%)
WD40 repeat 242..275 CDD:293791 6/35 (17%)
dync2i2NP_001099160.1 WD40 66..481 CDD:225201 73/363 (20%)
WD40 repeat 130..180 CDD:293791 12/81 (15%)
WD40 repeat 187..229 CDD:293791 11/43 (26%)
WD40 repeat 235..296 CDD:293791 12/65 (18%)
WD40 repeat 301..338 CDD:293791 10/36 (28%)
WD40 repeat 361..399 CDD:293791 8/28 (29%)
WD40 repeat 403..442 CDD:293791
WD40 repeat 450..477 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453532at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.