DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13074 and Dnai2

DIOPT Version :9

Sequence 1:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster


Alignment Length:482 Identity:88/482 - (18%)
Similarity:143/482 - (29%) Gaps:163/482 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EQRVVSSKDVEYDERALAKWLRQICPMVER--------------ELMNPTPLME----------- 96
            ||.|...:.:|.||..:.:.:....||...              |.::|.||.|           
  Fly    88 EQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPLPEPCKSRTVNVYR 152

  Fly    97 --------------------DLTMSQCRLEEKLQVYTYQKLIMGGAENSQ-GLAIWLCVHTNNAP 140
                                .:.:|.|.:.           ..|...|.: ...||. |...|.|
  Fly   153 DPNPIKVPVKHLSWSPDGGIKMAVSHCDMR-----------FQGDKSNQKCNSYIWE-VENPNEP 205

  Fly   141 VLVATTVAPHDDWCEHVDQQLKLFVPQRMSVGNLVIY-TEAKTLPLKSCLRSLC-TNPFNKTMFA 203
            .|......|  ..|...:|:....:...|..|.:..: |....||:....|.:| .:|.|..::.
  Fly   206 FLTLEPKVP--CVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMISEREVCHRDPVNSVLWN 268

  Fly   204 GSTMDGELFIWLYEQARGSDSSV---DIKQLYSVSSTQGAAVALDWPREHLLLACFANGSVRQWD 265
            .|....|.|      :.|||..|   |.::|..             |.:.||:....:.   ..|
  Fly   269 NSKSGTEFF------SGGSDGQVLWWDTRKLTE-------------PLDRLLMDPVKSD---DQD 311

  Fly   266 LSRQ---MALDWEYTLPATVSSEPTAMVTLGLDDFVVGTNDGGVYRCWNTGRQTAAIKQIKLLAL 327
            |||.   ..|::|.|:|..               |:.||..|.::.|...|:......||:::. 
  Fly   312 LSRSYGISVLEYETTIPTR---------------FMAGTEMGMLFSCNRKGKTPTEKIQIRMMC- 360

  Fly   328 RRHRFMVSTLLRTEMEGNLFVLSCDLSGQAFYHDMR-------------LVDE------------ 367
              |...|..:.|.......|:...|...:.:..|.|             |.|.            
  Fly   361 --HLGPVYAITRNPAFVKNFLTVGDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFI 423

  Fly   368 -------DMAQLIVQIPLPFKNVIAC---------SRDGNIIFCPANDGSLEYYRVSDGAHAHVK 416
                   |...|:.|...|...|..|         :.:|..:.|.:..|:.....|||       
  Fly   424 TRMDGVLDTWDLLQQQNEPVLTVKVCDEPLYCVRTNENGKFVSCGSQLGATFLVEVSD------- 481

  Fly   417 GGLRGKGSLIRSSDNGRWLIAGLYGDE 443
                   :::.|:.|.:.|:..::..|
  Fly   482 -------NMVMSAKNDKPLLTAMFERE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 13/48 (27%)
WD40 repeat 242..275 CDD:293791 8/35 (23%)
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 71/389 (18%)
WD40 repeat 162..208 CDD:293791 9/57 (16%)
WD40 212..469 CDD:295369 57/298 (19%)
WD40 repeat 215..254 CDD:293791 7/38 (18%)
WD40 repeat 262..304 CDD:293791 13/60 (22%)
WD40 repeat 318..355 CDD:293791 10/51 (20%)
WD40 repeat 365..401 CDD:293791 6/35 (17%)
WD40 repeat 408..433 CDD:293791 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.