DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13074 and Dic61B

DIOPT Version :9

Sequence 1:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_728477.1 Gene:Dic61B / 38020 FlyBaseID:FBgn0263988 Length:764 Species:Drosophila melanogaster


Alignment Length:161 Identity:30/161 - (18%)
Similarity:58/161 - (36%) Gaps:61/161 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 NPFNKTMFAGSTMDGELFIWLYEQARGSDSSVDIKQLYSVSSTQGA------------AVALDWP 247
            :||..::.|         |.||      |.||:::.:.|:..|..|            .||:.|.
  Fly   440 SPFLPSLLA---------IGLY------DGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWI 489

  Fly   248 RE----------HLLLACFANGSVRQWDLSR--------QMALDWEYTLPATVSSEPTAMV---- 290
            ::          ...|:...:|||.::.:.:        ||.|:.....|..:...|::.:    
  Fly   490 KQVSDDDHETDIDPFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCES 554

  Fly   291 ------------TLGLDDFVVGTNDGGVYRC 309
                        .|..|.:.|.|::|.:::|
  Fly   555 NRHPQGLSITTHPLHKDIYYVLTDEGCIHKC 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 9/38 (24%)
WD40 repeat 242..275 CDD:293791 10/50 (20%)
Dic61BNP_728477.1 WD40 358..730 CDD:225201 30/161 (19%)
WD40 repeat 381..429 CDD:293791
WD40 433..711 CDD:295369 30/161 (19%)
WD40 repeat 434..473 CDD:293791 12/47 (26%)
WD40 repeat 552..599 CDD:293791 6/34 (18%)
WD40 repeat 604..637 CDD:293791
WD40 repeat 645..682 CDD:293791
WD40 repeat 691..727 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.