DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13074 and Sdic2

DIOPT Version :9

Sequence 1:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001285481.1 Gene:Sdic2 / 2768883 FlyBaseID:FBgn0053497 Length:543 Species:Drosophila melanogaster


Alignment Length:454 Identity:79/454 - (17%)
Similarity:145/454 - (31%) Gaps:154/454 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DAATGTQEKLHVATQTEQRVVSSKDVEYDERALAKWLRQICPMVERELMNPTPLMEDLTMSQCRL 105
            |:.....|:.|..       :|...|.||||    |.:..|             :..:..|.   
  Fly   166 DSEEANDERSHAR-------LSLNRVFYDER----WSKNRC-------------ITSMDWST--- 203

  Fly   106 EEKLQVYTYQKLIMGGAENSQGLAIWLCVHTNNAP---VLVATTVAPHDDWCEHVDQQLKLFVPQ 167
                   .:.:|::|...|::        .:.|.|   |:|..|             :.|...|:
  Fly   204 -------HFPELVVGSYHNNE--------ESPNEPDGVVMVWNT-------------KFKKSTPE 240

  Fly   168 RMSVGNLVIYTEAKTLPLKSCLRSLCTNPFNKTMFAGSTMDGELFIWLYEQARGSDSSVDIKQLY 232
                         .....:|.:.|.|...||..:..|.|..|::.:|        |:.|  ::..
  Fly   241 -------------DVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLW--------DNRV--QKRT 282

  Fly   233 SVSSTQGAAVALDWP----------REHLLLACFANGSVRQWDLSR----QMALDWEYTLPATVS 283
            .:..|..:|.|...|          ..|.:::..::|.:..|.|..    |..|:.:......::
  Fly   283 PIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLELQQRQSKAIA 347

  Fly   284 SEPTAMVTLGLDDFVVGTNDGGVYRCWNTGRQTAAIKQIKLLALRRHRFMVSTLLRTEME----- 343
            ....|.....::..|:|:.||.||.....|.: :.:.::    ..||...: |.:.|...     
  Fly   348 ITSMAFPANEINSVVMGSEDGYVYSASRHGLR-SGVNEV----YERHLGPI-TGISTHYNQLSPD 406

  Fly   344 -GNLFVLSCDLSGQAFYHDMRLVD-----------------EDMAQLIVQIP-LPFKNVIACSRD 389
             |:||:.|.             :|                 ||.:..::.:. .|....:..:.|
  Fly   407 FGHLFLTSS-------------IDWTIKLWSLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVD 458

  Fly   390 GNIIFCPANDGSLEYYRVSDGAHAHVKG-GLRGKGSLIRSSDNGRWLIAGLY---GDEFQIFYV 449
            |:        |.|:.:.::......... .:.|..:|.|.|    |..:||:   |||....||
  Fly   459 GS--------GRLDLWNLNQDTEVPTASIVVAGAPALNRVS----WTPSGLHVCIGDEAGKLYV 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 10/44 (23%)
WD40 repeat 242..275 CDD:293791 8/46 (17%)
Sdic2NP_001285481.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 3/11 (27%)
WD40 196..512 CDD:295369 68/400 (17%)
WD40 repeat 196..245 CDD:293791 11/92 (12%)
WD40 <224..523 CDD:225201 62/354 (18%)
WD40 repeat 251..289 CDD:293791 11/47 (23%)
WD40 repeat 298..337 CDD:293791 5/38 (13%)
WD40 repeat 349..435 CDD:293791 17/104 (16%)
WD40 repeat 441..479 CDD:293791 5/45 (11%)
WD40 repeat 487..513 CDD:293791 11/28 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453532at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.