DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13074 and Dync1i2

DIOPT Version :9

Sequence 1:NP_648835.1 Gene:CG13074 / 39760 FlyBaseID:FBgn0036567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001185801.1 Gene:Dync1i2 / 13427 MGIID:107750 Length:655 Species:Mus musculus


Alignment Length:374 Identity:72/374 - (19%)
Similarity:131/374 - (35%) Gaps:111/374 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VEFP---------------ATQPLEKQHALVDNCTGTDPPPPSQ------DAATGTQEKLHVATQ 55
            |:||               ..||.|.:....|..|...|..|.:      |....::...|..|:
Mouse   163 VDFPPREIVTYTKETQTPVTAQPKEDEEEEDDVATPKPPVEPEEEKTLKKDEENDSKAPPHELTE 227

  Fly    56 TE-QRVVSSKD--------VEYDERALAKWLRQICPMVERELMNPTPLMED----------LTMS 101
            .| |:::.|::        ....||||::.:........|:|       ||          |:::
Mouse   228 EEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDL-------EDKEGEIQAGAKLSLN 285

  Fly   102 QCRLEEKLQVYTYQKLIMGGAENSQGLAIWLCVHTNNAPVLVATTVAPHDDWCEHVDQQLKLFVP 166
            :...:|:   ::..:::.....:||...:.:..:.||..       |||:              |
Mouse   286 RQFFDER---WSKHRVVSCLDWSSQYPELLVASYNNNEE-------APHE--------------P 326

  Fly   167 QRMS-VGNLVIYTEAKTLP-----LKSCLRSLCTNPFNKTMFAGSTMDGELFIW-------LYEQ 218
            ..:: |.|:   ...||.|     .:|.:.|.....|:..:..|.|..|::.:|       ...|
Mouse   327 DGVALVWNM---KYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQ 388

  Fly   219 ARGSDSSVDIKQLYSVS--STQGAAVALDWPREHLLLACFANGSVRQWDL--------SRQMALD 273
            .....::.....:|.|:  .||.|         |.|::...:|.:..|.|        |.::...
Mouse   389 RTPLSAAAHTHPVYCVNVVGTQNA---------HNLISISTDGKICSWSLDMLSHPQDSMELVHK 444

  Fly   274 WEYTLPATVSSEPTAMVTLGLDDFVVGTNDGGVYRCWNTGRQTAAIKQI 322
            ....:..|..|.|...|    ::||||:.:|.||.....|.: |.|.::
Mouse   445 QSKAVAVTSMSFPVGDV----NNFVVGSEEGSVYTACRHGSK-AGISEM 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13074NP_648835.1 WD40 repeat 189..234 CDD:293791 8/51 (16%)
WD40 repeat 242..275 CDD:293791 6/40 (15%)
Dync1i2NP_001185801.1 Dynein_IC2 152..180 CDD:288403 3/16 (19%)
WD40 repeat 299..348 CDD:293791 13/72 (18%)
WD40 346..>616 CDD:225201 33/157 (21%)
WD40 repeat 356..394 CDD:293791 6/37 (16%)
WD40 397..>622 CDD:295369 25/106 (24%)
WD40 repeat 402..443 CDD:293791 11/49 (22%)
WD40 repeat 451..498 CDD:293791 14/43 (33%)
WD40 repeat 506..538 CDD:293791
WD40 repeat 544..582 CDD:293791
WD40 repeat 590..616 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453532at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.