DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ClC-c and YCR001W

DIOPT Version :9

Sequence 1:NP_001261922.1 Gene:ClC-c / 39759 FlyBaseID:FBgn0036566 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_001335748.1 Gene:YCR001W / 850357 SGDID:S000000594 Length:104 Species:Saccharomyces cerevisiae


Alignment Length:154 Identity:26/154 - (16%)
Similarity:49/154 - (31%) Gaps:64/154 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 LRSLTPFGNEHSVLFFVEYNKPWIFFELIPFVFLGIMGGVIGTFFIKANLWWCRYRKFSKLGQYP 505
            |:.:..:|..:..:|::::..||....|:|.::        |......|.|.|.     ||.:: 
Yeast     8 LKHIDSYGESNLSMFYLKFYCPWKLCPLLPILY--------GRNKSVQNAWSCH-----KLHRF- 58

  Fly   506 VMEVLFVTLVTAIICYPNPFTRMNMNELIFLLVSKCSPGDVTNPLCDYKRMNITSGNSFIEVTEP 570
                         |.:|.|...||    .|..:..|                             
Yeast    59 -------------IDFPTPSANMN----FFFFIRVC----------------------------- 77

  Fly   571 GPGVYSSIWLLMLTFILKLALTIF 594
                |.::.|.:.||:.|::..|:
Yeast    78 ----YGTVSLFISTFLKKISFFIY 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClC-cNP_001261922.1 ClC_3_like 215..719 CDD:239656 26/154 (17%)
Voltage_CLC 298..699 CDD:279048 26/154 (17%)
CBS 738..876 CDD:223591
CBS_pair_EriC_assoc_euk_bac 741..878 CDD:239964
YCR001WNP_001335748.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0038
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.