DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tasp1 and ASRGL1

DIOPT Version :9

Sequence 1:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001077395.1 Gene:ASRGL1 / 80150 HGNCID:16448 Length:308 Species:Homo sapiens


Alignment Length:266 Identity:98/266 - (36%)
Similarity:135/266 - (50%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGFVAVHTGAGNCIDETKYQRVIKEACLRATE----ILRNGGSAVDACEAAIVRLENCGYTNAG 61
            |...|.||.|....|.:.:.:|| .:..:||..    |||.|||||||.|.|:|.||:....|||
Human     1 MNPIVVVHGGGAGPISKDRKERV-HQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAG 64

  Fly    62 YGSNLCMDGSVQCDAAIMDGSTLNFGACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGT 126
            .||.|..:|.|:.||:||||..|:.||.:.|..:.|||:|||.:         :|:.|...|...
Human    65 CGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLV---------MEKTPHCFLTDQ 120

  Fly   127 GAEHYADEVGCSMVEPGVLISSKAKFQFNHYKSKYDLVVNSRLGKATSEESVQVPEPGNEVELAA 191
            ||..:|..:|...:....|::.:.|               .||.|...|:..|      :.:...
Human   121 GAAQFAAAMGVPEIPGEKLVTERNK---------------KRLEKEKHEKGAQ------KTDCQK 164

  Fly   192 ALDTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCTTGNGEYLM 256
            .|.|||||.:|..||.|...|:|||:.|:.||||.:...|||.:| |.|..|::  |||:||.::
Human   165 NLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYA-DNDIGAVS--TTGHGESIL 226

  Fly   257 KTLLAR 262
            |..|||
Human   227 KVNLAR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 97/264 (37%)
ASRGL1NP_001077395.1 PRK10226 1..290 CDD:182319 98/266 (37%)
ASRGL1_like 2..291 CDD:271338 97/265 (37%)
Substrate binding 196..199 2/2 (100%)
Substrate binding 219..222 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000907
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3264
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.