DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tasp1 and si:dkey-103j14.5

DIOPT Version :9

Sequence 1:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_005156981.3 Gene:si:dkey-103j14.5 / 570552 ZFINID:ZDB-GENE-090313-170 Length:361 Species:Danio rerio


Alignment Length:336 Identity:103/336 - (30%)
Similarity:151/336 - (44%) Gaps:58/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGFVAVHTGAGNCIDETKYQRV--IKEACLRATEILRNGGSAVDACEAAIVRLENCGYTNAGYG 63
            |...:.||.||.:..|......|  :|.|......:||.|.||:||.|.|:..||:....:||:|
Zfish    55 MKTVIVVHGGAWSIPDALAESSVAGVKAAARAGDAVLRTGRSAIDAVETAVRCLEDDPTFDAGHG 119

  Fly    64 SNLCMDGSVQCDAAIMDGSTLNFGACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGA 128
            |.|.:.|.|:.|:.||||.||..||..:|..:.||:.|||.:         :|:...::|...||
Zfish   120 SVLNISGEVELDSIIMDGETLAAGAVASVRNIANPVSLARAV---------MEKTDHVMLTDRGA 175

  Fly   129 EHYADEVGCSMVEPGVLISSKAKFQFNHYKSKYDLV---VNSRLGKATSEESVQVPEPGNEVELA 190
            ..:|:.:|..:...  |::...:.::.|.||..|.|   .|::.|.                   
Zfish   176 SMFAEHIGTPVAHD--LVTELERKEWEHSKSYPDGVKKFFNTQWGH------------------- 219

  Fly   191 AALDTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCTTGNGEYL 255
               ||||||.:|.:||.|...|:|||..|:.||||.:...|:|.:|   |..:.|...||:||.:
Zfish   220 ---DTVGAVALDSSGNVACATSTGGIRNKMVGRVGDSPIIGSGGYA---DNRSGAVSCTGHGESI 278

  Fly   256 MKTLLAREICHGAFSSDCAVTSLHKTFKQKFLDSPLLPRQQDLYAGALTLLYYPGQSSGEVMWSH 320
            :|..|||.|.........||.:...:.:..        .|:....|...||    .|:|:  |  
Zfish   279 LKVTLARLILFHVEQGKSAVGAAEASLQYM--------SQRVKGCGGAVLL----SSTGD--W-- 327

  Fly   321 TTQSFCVGYMA 331
             |.||....||
Zfish   328 -TASFTTPRMA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 102/334 (31%)
si:dkey-103j14.5XP_005156981.3 ASRGL1_like 56..344 CDD:271338 102/335 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000907
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3264
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.