DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tasp1 and CG4372

DIOPT Version :9

Sequence 1:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster


Alignment Length:319 Identity:76/319 - (23%)
Similarity:124/319 - (38%) Gaps:80/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EACLRATEILRNG-----GSAVDACEAAIVRLENCGYTNAGYGSNLCMDGSVQCDAAIMDGSTLN 85
            :|.|:|..:|:.|     .:.:..|.|.  :.:.||....| .|:...:|::..:||||||.:|.
  Fly    63 DANLQAWSVLQQGPRRTRQAVIQGCMAC--QNQRCGRLLTG-RSSPDTEGALTLEAAIMDGESLE 124

  Fly    86 FGACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGAEHYADEVGCSMVEPGVLISSKA 150
            :||...::.|:|.|.:|    ||     :|:.....:|.|..|..:|..:|              
  Fly   125 YGAVAGMNGVRNAILVA----DA-----VLKYTKHSVLVGKSATKFARSLG-------------- 166

  Fly   151 KFQFNHYKSKY--DLVVNSRLGKATS--------------------------EESVQVPEPGNEV 187
                  ||.:|  |....:.|.|..|                          |...|.|......
  Fly   167 ------YKEEYLTDARTRNVLKKWRSNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQHPMHQEYA 225

  Fly   188 ELAAALDTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCTTGNG 252
            .:....|.:..:.:|..|.......|.|...::|||||.:|..|||.:|.:....|:|   :|:|
  Fly   226 IIQGQHDQLAFLALDAEGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVA---SGDG 287

  Fly   253 EYLMKTL---LAREICHGAFSSDCAVTSL------HKTFKQKFLDSPLLPRQQDLYAGA 302
            :.||:.|   ||.|........|.|...:      |.|   :|..:.::..::.:||.|
  Fly   288 DVLMRHLPAFLAVEAMRAGKEPDKAAELVVQRLLRHNT---EFNGAVVVVNRRGIYAAA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 76/319 (24%)
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 76/319 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.