DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tasp1 and Aga

DIOPT Version :9

Sequence 1:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_006253173.1 Gene:Aga / 290923 RGDID:1309646 Length:364 Species:Rattus norvegicus


Alignment Length:337 Identity:95/337 - (28%)
Similarity:145/337 - (43%) Gaps:75/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LRNGGSAVDACE--AAIVRLENCGYTNAGYGSNLCMDGSVQCDAAIMDGSTLNFGACTNVSRVKN 97
            |.:||||:||.|  .|:...|.||.| .|:|.:....|....||.||||:.::.||...:.|:||
  Rat    66 LVSGGSALDAVEKGCAMCEKEQCGGT-VGFGGSPDEVGETTLDAMIMDGTAMDVGAVGGLRRIKN 129

  Fly    98 PIQLARRICDAQSSPQLLERIPPMILAGTGAEHYADEVGCSMVEPGVLISS-------KAKFQFN 155
            .|.:||::         ||.....:|.|..|..:|..:|.:..:.....|.       ....|.|
  Rat   130 AIGVARKV---------LEHTTHTLLVGDSATKFAVSMGFTSEDLSTNTSRALHSDWLSRNCQPN 185

  Fly   156 HYK------SKY--------DLVVNSRLGKATSEESVQVPEPGNEVELAAALDTVGAVCVDGAGN 206
            :::      |||        .|..|:|..|              ||::.:. ||:|.|.:...|:
  Rat   186 YWRNVIPDPSKYCGPYKPPDFLEQNNRAHK--------------EVDIHSH-DTIGMVVIHKTGH 235

  Fly   207 TAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCTTGNGEYLMKTLLAREICHGAFSS 271
            ||||.|:.|:..|:|||||.:...|||.:|   |::|.|...||:|:.|::.|.:.:........
  Rat   236 TAAGTSTNGLKFKIPGRVGDSPIPGAGAYA---DDMAGAAAATGDGDTLLRFLPSYQAVEYMRGG 297

  Fly   272 DCAVTSLHKTFKQKFLDSPLLPRQQDLYAGALTLLYYPGQSSGEVMWSHTTQSFCVGYMATNQRV 336
            |....:..|          ::.|.|.         ||| :..|.|:.::.|.|    |.|...|:
  Rat   298 DDPARACQK----------VISRIQK---------YYP-KFFGAVICANVTGS----YGAACNRL 338

  Fly   337 PKFVHSPLPTYS 348
            |.|.......|:
  Rat   339 PTFTQFSFMVYN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 95/337 (28%)
AgaXP_006253173.1 Glycosylasparaginase 29..350 CDD:271335 94/335 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.