DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tasp1 and Asrgl1

DIOPT Version :9

Sequence 1:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_659557.1 Gene:Asrgl1 / 246307 RGDID:708526 Length:333 Species:Rattus norvegicus


Alignment Length:262 Identity:98/262 - (37%)
Similarity:131/262 - (50%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAVHTGAGNCIDETKYQRVIKEACLRATE---ILRNGGSAVDACEAAIVRLENCGYTNAGYGSNL 66
            |.||.|..:.|...:.:.|.:.....|||   ||:.|||||||.|.|:..|||....||||||.|
  Rat    28 VVVHGGGASNISPGRKELVSEGIAKAATEGYNILKAGGSAVDAVEGAVTMLENDPEFNAGYGSVL 92

  Fly    67 CMDGSVQCDAAIMDGSTLNFGACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGAEHY 131
            ..||.::.||:||||..|:.||.:.|..:.||::|||.:         :|:.|...|.|.|||.:
  Rat    93 NADGDIEMDASIMDGKDLSAGAVSAVRCIANPVKLARLV---------MEKTPHCFLTGRGAEKF 148

  Fly   132 ADEVGCSMVEPGVLISSKAKFQFNHYKSKYDLVVNSRLGKATSEESVQVPE-PGNEVELAAALDT 195
            |.::|........||:.:.|               ..|.|...|:..|..: |.|.       .|
  Rat   149 AADMGIPQTPAEKLITERTK---------------KHLEKEKLEKGAQKADCPKNS-------GT 191

  Fly   196 VGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCTTGNGEYLMKTLL 260
            ||||.:|..||.|...|:|||:.|:.||||.:...|||.:|   |....|..|||:||.::|..|
  Rat   192 VGAVALDCKGNLAYATSTGGIVNKMVGRVGDSPCIGAGGYA---DNNLGAVSTTGHGESILKVNL 253

  Fly   261 AR 262
            ||
  Rat   254 AR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 98/262 (37%)
Asrgl1NP_659557.1 ASRGL1_like 25..314 CDD:271338 98/262 (37%)
PRK10226 27..306 CDD:182319 98/262 (37%)
Substrate binding. /evidence=ECO:0000250 219..222 2/2 (100%)
Substrate binding. /evidence=ECO:0000250 242..245 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000907
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.