DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tasp1 and tasp-1

DIOPT Version :9

Sequence 1:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001379234.1 Gene:tasp-1 / 176508 WormBaseID:WBGene00010480 Length:331 Species:Caenorhabditis elegans


Alignment Length:279 Identity:87/279 - (31%)
Similarity:124/279 - (44%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAVHTGAGNCIDETKYQRVIKEACLRATEILRNGGSAVDACEAAIVRLENCGYTNAGYGSNLCMD 69
            :|||.||  |   .|:...:.|.|..|.     |...|   |.|:..||.....|.|:||:|.:|
 Worm     7 IAVHGGA--C---AKFDASLAEDCRFAC-----GTGTV---ENALTDLERIEKFNCGFGSHLTID 58

  Fly    70 GSVQCDAAIMDGSTLNFGACTNVSRVKNPIQLARRICDAQ--SSPQLLERIPPMILAGTGAEHYA 132
            ..|:|:|:.|....|:|||...:|.|.:|.::||.:..:.  ...:||.   |:||.|.|||.||
 Worm    59 QEVECEASYMSSKNLSFGAVGAISNVFHPSRVARHLAHSNWWKQRRLLH---PLILVGRGAEKYA 120

  Fly   133 DEVGCSMVEPGVLISSKAKFQFNHYKSK----YDLVVNSRLGKATSEESVQVPEPGNEVELAAAL 193
            .:.......|..|:|..||..|..|..:    ||                             ..
 Worm   121 VKNDFPTCTPEELVSKAAKESFEKYLHRMLHPYD-----------------------------TH 156

  Fly   194 DTVGAVCVD-GAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWA---------TDTDELAIATCT 248
            |||||:.:: ...|:.:|.|||||:||..||:|.:..||:|.|:         ....|..|:.|:
 Worm   157 DTVGAISINTNTMNSESGTSSGGIVLKHSGRLGHSCVYGSGTWSERRQYEEPFDQVSERTISICS 221

  Fly   249 TGNGEYLMKTLLAREICHG 267
            ||:||.|:|.    :.|.|
 Worm   222 TGHGESLVKA----DFCRG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 87/279 (31%)
tasp-1NP_001379234.1 Taspase1_like 5..304 CDD:271336 87/279 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156586
Domainoid 1 1.000 102 1.000 Domainoid score I4340
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9795
Inparanoid 1 1.050 103 1.000 Inparanoid score I3546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1450528at2759
OrthoFinder 1 1.000 - - FOG0000907
OrthoInspector 1 1.000 - - otm14770
orthoMCL 1 0.900 - - OOG6_104158
Panther 1 1.100 - - LDO PTHR10188
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3264
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.