Sequence 1: | NP_001261920.1 | Gene: | Tasp1 / 39757 | FlyBaseID: | FBgn0263602 | Length: | 365 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000018.2 | Gene: | AGA / 175 | HGNCID: | 318 | Length: | 346 | Species: | Homo sapiens |
Alignment Length: | 271 | Identity: | 78/271 - (28%) |
---|---|---|---|
Similarity: | 111/271 - (40%) | Gaps: | 76/271 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 KEACLRATEILRNGGSAVDACEA--AIVRLENCGYTNAGYGSNLCMDGSVQCDAAIMDGSTLNFG 87
Fly 88 ACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGAEHYADEVGCSMVEPGVLISSKAKF 152
Fly 153 QFNHYKSKYDLVVNSRLGKATSE--------ESVQ-------VPEPG------------------ 184
Fly 185 -NEVELAAALDTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCT 248
Fly 249 TGNGEYLMKTL 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tasp1 | NP_001261920.1 | Taspase1_like | 3..364 | CDD:271336 | 78/271 (29%) |
AGA | NP_000018.2 | Glycosylasparaginase | 29..332 | CDD:271335 | 78/271 (29%) |
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 | 234..237 | 2/2 (100%) | |||
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 | 257..260 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1446 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |