DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tasp1 and AGA

DIOPT Version :9

Sequence 1:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_000018.2 Gene:AGA / 175 HGNCID:318 Length:346 Species:Homo sapiens


Alignment Length:271 Identity:78/271 - (28%)
Similarity:111/271 - (40%) Gaps:76/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KEACLRATEILRNGGSAVDACEA--AIVRLENCGYTNAGYGSNLCMDGSVQCDAAIMDGSTLNFG 87
            |.|...|...|.:||||:||.|:  |:...|.|. .:.|:|.:....|....||.||||:|::.|
Human    37 KNATEAAWRALASGGSALDAVESGCAMCEREQCD-GSVGFGGSPDELGETTLDAMIMDGTTMDVG 100

  Fly    88 ACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGAEHYADEVGCSMVEPGVLISSKAKF 152
            |..::.|:||.|.:||::         ||.....:|.|..|..:|..:|                
Human   101 AVGDLRRIKNAIGVARKV---------LEHTTHTLLVGESATTFAQSMG---------------- 140

  Fly   153 QFNHYKSKYDLVVNSRLGKATSE--------ESVQ-------VPEPG------------------ 184
                       .:|..|....|:        .:.|       :|:|.                  
Human   141 -----------FINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGILKQDIPI 194

  Fly   185 -NEVELAAALDTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCT 248
             .|.|.....||:|.|.:...|:.|||.|:.||..|:.||||.:...|||.:|.||   |.|...
Human   195 HKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDT---AGAAAA 256

  Fly   249 TGNGEYLMKTL 259
            ||||:.||:.|
Human   257 TGNGDILMRFL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 78/271 (29%)
AGANP_000018.2 Glycosylasparaginase 29..332 CDD:271335 78/271 (29%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 234..237 2/2 (100%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 257..260 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.