DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and APD2

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_195765.3 Gene:APD2 / 831860 AraportID:AT5G01450 Length:444 Species:Arabidopsis thaliana


Alignment Length:108 Identity:31/108 - (28%)
Similarity:53/108 - (49%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 LSSEEAV--SGDVAPSVA-----PTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGA 397
            ::.:|.|  :.||||.:.     .::....::.|:.:|. .....:..|.:|  ...||.|||.|
plant   338 VTEDETVDENDDVAPLIPGKDDDNSSWCSSYSSILTSTE-ELEGAHGEGHSS--TRYLCAICYDA 399

  Fly   398 EYNTAFLPCGHVVACAKCASSVTK----CPLCRKPFTDVMRVY 436
            ..:..||.|||.|||.:|.:.:.:    ||:|||....|.:::
plant   400 PRDCFFLSCGHCVACFQCGTRIAETSGFCPVCRKKIRKVKKIF 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595
zf-C3HC4_3 387..432 CDD:290631 20/48 (42%)
APD2NP_195765.3 DUF4792 129..197 CDD:406448
DUF4793 221..328 CDD:406449
RING_Ubox 392..431 CDD:418438 17/38 (45%)
RING-HC finger (C3HC4-type) 393..431 CDD:319361 16/37 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.