DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and APD3

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_181357.2 Gene:APD3 / 818401 AraportID:AT2G38220 Length:404 Species:Arabidopsis thaliana


Alignment Length:311 Identity:64/311 - (20%)
Similarity:98/311 - (31%) Gaps:99/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 SAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPH----------------------QLAEAGF 252
            |..|| ||..:.|..:.:....:::.||..|.:..|                      |:....|
plant   107 STPSG-YFVNWTESRVLSVSQNSYKGWPYYLNRGTHMNISYNILPKGSAVRLVITEGSQVIGMPF 170

  Fly   253 FYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVA----------- 306
            ||.            ..|.|....|..|..:.:..|....:.:.|.:.|..|||           
plant   171 FYR------------SSLKDIAFRDTAWSWNLIQGSGMIQLDISKSKGYYLTVANLKRKDIEVEL 223

  Fly   307 ---AKPVLAEEKEESSS-----------------IGGVAVASTQASEEEQQTSLSSEEAVSGDVA 351
               .|.||.:.|:.|.:                 :...||.::.|.  .|..|:..|..:.....
plant   224 DIDVKAVLYDTKQTSYNCSFSNGECSFKMNERYPVENYAVVTSPAL--GQGVSIDDEWYIELSYQ 286

  Fly   352 PSVAP------------TAATRIFNKI--------------VEATAVATPSTNS-SGSTSIPEEK 389
            |.:..            ..|....||:              |....:|....|. ........:.
plant   287 PRLIAYGSFTGVLLSFMLVAIHFCNKLKCCGGEGFLSGDDSVRTCLLADKGDNDCCNDVEASNKS 351

  Fly   390 LCKICYGAEYNTAFLPCGHVVACAKCASSVT----KCPLCRKPFTDVMRVY 436
            ||.||:.|..:..||||||.|:|.:|.:.:.    :||:|||....|.|:|
plant   352 LCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKMIHVKRIY 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595 13/90 (14%)
zf-C3HC4_3 387..432 CDD:290631 19/48 (40%)
APD3NP_181357.2 DUF4792 98..164 CDD:374322 10/57 (18%)
DUF4793 196..306 CDD:374323 17/111 (15%)
zf-C3HC4_3 349..394 CDD:372816 18/44 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.