DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and APD1

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_973633.2 Gene:APD1 / 818397 AraportID:AT2G38185 Length:447 Species:Arabidopsis thaliana


Alignment Length:243 Identity:53/243 - (21%)
Similarity:81/243 - (33%) Gaps:100/243 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 PSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRC---------- 263
            |:|:.|        .:||       :.|......:|.::|    :..|.| .|.|          
plant   288 PAASQG--------VSIE-------DEWYIRFSYQPREIA----YVIGTG-VVICFMLVAIQFCN 332

  Fly   264 -FSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVA 327
             |.|.||                           :|.|..|..|...:||::.::.||:|     
plant   333 RFQCSGG---------------------------EGHLTEDDSARTRLLADKDDDGSSMG----- 365

  Fly   328 STQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCK 392
            |...|.......|  ||.:..|                               |..|....:||.
plant   366 SCDDSYANDDADL--EEFMGND-------------------------------GEASNRSRRLCA 397

  Fly   393 ICYGAEYNTAFLPCGHVVACAKCASSVTK----CPLCRKPFTDVMRVY 436
            ||:....:..||||||.|:|.:|.:::.:    ||:||:....|.|:|
plant   398 ICFDVPRDCFFLPCGHSVSCYECGTTMQEADGSCPICRRKMKKVKRIY 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595 12/79 (15%)
zf-C3HC4_3 387..432 CDD:290631 17/48 (35%)
APD1NP_973633.2 DUF4792 120..187 CDD:292659
DUF4793 217..326 CDD:292660 12/57 (21%)
zf-C3HC4_3 392..441 CDD:290631 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.