DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and BIRC7

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_647478.1 Gene:BIRC7 / 79444 HGNCID:13702 Length:298 Species:Homo sapiens


Alignment Length:379 Identity:100/379 - (26%)
Similarity:144/379 - (37%) Gaps:101/379 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGAN 140
            |..||...|.:...|...|.|..|  |..|       |:..:            |.:..|.|.|.
Human     5 DSAKCLHRGPQPSHWAAGDGPTQE--RCGP-------RSLGS------------PVLGLDTCRAW 48

  Fly   141 DSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPE 205
            |                             :..|.:.|...|               .|.:.:.|
Human    49 D-----------------------------HVDGQILGQLRP---------------LTEEEEEE 69

  Fly   206 TCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGL 270
            ....:.:.|   |.:|....|..||.:|..||...:..|..||.||||:||..|:||||.|.|||
Human    70 GAGATLSRG---PAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGL 131

  Fly   271 MDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTV--AAKPVLA-----EEKEESSSIGGVAVAS 328
            ..|...|:||.:||.|...|:|:...||:.::.:|  ....:|.     ||.|:::.:.....||
Human   132 QSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPAS 196

  Fly   329 TQASEEEQQTSLSSEEAVS-GDVAPSVA--------PTAATRIFNKIVEATAVATPSTNSSGSTS 384
            ........:..:.||.|.. |.|:|:.|        |..|     :.|||..           ..
Human   197 GYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGA-----RDVEAQL-----------RR 245

  Fly   385 IPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS 438
            :.||:.||:|.....:..|:||||:| ||:||..:..||:||.|....:|.:.|
Human   246 LQEERTCKVCLDRAVSIVFVPCGHLV-CAECAPGLQLCPICRAPVRSRVRTFLS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595 10/35 (29%)
BIR 226..295 CDD:197595 33/68 (49%)
zf-C3HC4_3 387..432 CDD:290631 20/44 (45%)
BIRC7NP_647478.1 BIR 88..155 CDD:237989 32/66 (48%)
zf-C3HC4_3 248..292 CDD:290631 20/44 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 1 1.000 - - FOG0000512
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100552
Panther 1 1.100 - - LDO PTHR10044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.