DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and birc5l

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001037948.1 Gene:birc5l / 733575 XenbaseID:XB-GENE-966741 Length:139 Species:Xenopus tropicalis


Alignment Length:75 Identity:30/75 - (40%)
Similarity:41/75 - (54%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LNREETRLKTFTDWPLD---WLDKRQLAQTGMYFTH-----AGDKVKCFFCGVEIGCWEQEDQPV 97
            |.|..|||.||.:||..   .....::|:.|  |.|     :.|.||||||..|:..|:.||.|:
 Frog     7 LYRLATRLSTFANWPFTEDCACTPERMAEAG--FVHCPSDNSPDVVKCFFCLKELEGWQPEDDPM 69

  Fly    98 PEHQRWSPNC 107
            .||::.||:|
 Frog    70 DEHKKHSPSC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595 28/72 (39%)
BIR 226..295 CDD:197595
zf-C3HC4_3 387..432 CDD:290631
birc5lNP_001037948.1 BIR 13..82 CDD:306999 27/69 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.