powered by:
Protein Alignment Diap1 and birc5
DIOPT Version :9
Sequence 1: | NP_001261916.1 |
Gene: | Diap1 / 39753 |
FlyBaseID: | FBgn0260635 |
Length: | 438 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001037919.1 |
Gene: | birc5 / 733532 |
XenbaseID: | XB-GENE-5850943 |
Length: | 160 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 28/75 - (37%) |
Similarity: | 37/75 - (49%) |
Gaps: | 5/75 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 228 ARLRTFEAWP--RNLKQKPHQLAEAGFFY---TGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWL 287
|||.||..|| .|.|..|..:|:|||.: ....|...||.|...|..|..:|:||.:|:...
Frog 26 ARLATFADWPFTENCKCTPENMAKAGFVHCPTENEPDVACCFFCLKELEGWEPDDDPWTEHSKRS 90
Fly 288 SQCRFVKLMK 297
:.|.|:.|.|
Frog 91 ASCGFLSLTK 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.