DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and mylipb

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001073491.1 Gene:mylipb / 565911 ZFINID:ZDB-GENE-061027-67 Length:464 Species:Danio rerio


Alignment Length:271 Identity:58/271 - (21%)
Similarity:88/271 - (32%) Gaps:87/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PRVTVATHAS-----TATQATGD---VQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNL 240
            |.:.:||.:.     |.|:..||   :..:...||||:|.|                        
Zfish   225 PVIQMATQSGRNVYVTITKDNGDSVVLLFKFVSPSAANGLY------------------------ 265

  Fly   241 KQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYI-DT 304
                ..:.|...||       ||.:....:......|......:|:|::    .:..|:.|| |.
Zfish   266 ----RAITEIHAFY-------RCDTVMSTVKMQYSRDFKGHLASLFLNE----SIDLGKRYIFDI 315

  Fly   305 VAAKPVLAEEKEESSSIGGVAVASTQASEE-EQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVE 368
            ......:.:....:....||:|.....|.. .:||.:..||.:..|..                 
Zfish   316 QRTSKEVYDRTRRALFNAGVSVNGRGISRSLLRQTKVDREERMCVDCR----------------- 363

  Fly   369 ATAVATPSTNSSGSTSIPEEKL--------CKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLC 425
                         .|.:.:|||        |.:|...|.:.||.||||:..|..|||.:..||:|
Zfish   364 -------------ETHVLKEKLQRLQEALTCALCCEQEISAAFCPCGHMFCCYNCASQLQCCPVC 415

  Fly   426 RKPFTDVMRVY 436
            |.....|..||
Zfish   416 RSEVDRVQHVY 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595 8/68 (12%)
zf-C3HC4_3 387..432 CDD:290631 20/52 (38%)
mylipbNP_001073491.1 B41 3..190 CDD:214604
FERM_N 5..68 CDD:286467
FERM_M 85..190 CDD:278785
FERM_C_MYLIP_IDOL 185..295 CDD:270016 19/104 (18%)
zf-C3HC4_3 377..422 CDD:290631 17/44 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.