DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and NAIP

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001333799.1 Gene:NAIP / 4671 HGNCID:7634 Length:1403 Species:Homo sapiens


Alignment Length:440 Identity:103/440 - (23%)
Similarity:161/440 - (36%) Gaps:129/440 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSYGPIAFDQVDNNTNATQLFKNNINKTRMNDL--NREETRLKTFTDWP--LDWLDKRQLAQTGM 69
            |..|.:....|.|........||..::.|...:  ..||.||.:|.:||  :..:....|::.|.
Human   122 PDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGF 186

  Fly    70 YFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISY 134
            .||...|.|:||.||..:|.||:.|.|..||.:|.|.|..||.:.      ::|.:.:.:.  ||
Human   187 VFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKK------SSEEITQYIQ--SY 243

  Fly   135 DICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQAT 199
            .  |..|.|.|...:::.:..:||:...                                     
Human   244 K--GFVDITGEHFVNSWVQRELPMASAY------------------------------------- 269

  Fly   200 GDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCF 264
                   |..|.           :|.|..||.:|:.|||........||:||.||||:.|.|:||
Human   270 -------CNDSI-----------FAYEELRLDSFKDWPRESAVGVAALAKAGLFYTGIKDIVQCF 316

  Fly   265 SCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYI-----------------------DTVA 306
            ||||.|..|.:.|:|.:.|......|.|::.||....:                       |::|
Human   317 SCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTPDLQSRGELCELLETTSESNLEDSIA 381

  Fly   307 AKPVLAEEK-------EESSSIG-GVAVASTQASEEEQ-----QTSLSSEEAVSGDVA------- 351
            ..|::.|..       :|:.::. .:..|.|.||....     .:.|:::..:..|::       
Human   382 VGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMSLLDISSDLATDHLLGCDLSIASKHIS 446

  Fly   352 -PSVAPTAATRIFNKI-----VEATAVATPSTNSSGSTSIPEEKLCKICY 395
             |...|.....:|..:     ||..|       .||.|.:    |.||.:
Human   447 KPVQEPLVLPEVFGNLNSVMCVEGEA-------GSGKTVL----LKKIAF 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595 28/69 (41%)
BIR 226..295 CDD:197595 30/68 (44%)
zf-C3HC4_3 387..432 CDD:290631 3/9 (33%)
NAIPNP_001333799.1 BIR 1 60..127 2/4 (50%)
BIR 2 159..227 27/67 (40%)
BIR 3 278..345 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.