DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and Bruce

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:378 Identity:90/378 - (23%)
Similarity:135/378 - (35%) Gaps:91/378 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LNREETRLKTFTDWP-LD--WLDKRQLAQTGMYF---THAGDKVKCFFCGVEIGCWEQEDQPVPE 99
            ::.|..|.:||..|| :|  |....|:||.|.|.   :...|:..||.|.|.:.|||:.|:|..|
  Fly   245 MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSE 309

  Fly   100 HQRWSPNCPLLRRRTTNNVPIN-AEALDRILPP--ISYDICGANDSTLEMREHAYAEGVIPMSQL 161
            |:|.||.||.::...|.|||:: ..|.:..||.  :.:||...:|         ||         
  Fly   310 HERHSPLCPFVKGEYTQNVPLSITYATNPALPAPGLGFDIISNSD---------YA--------- 356

  Fly   162 IQSIGMNAVNAAGSVTG-----TAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYP 221
                  |.:..:.|.||     :.....::....|..|......:...|..|.:|..        
  Fly   357 ------NVLCTSCSQTGELSVWSIERHLKLMHTFHVPTLLNYIFEESFEWARVTAIC-------- 407

  Fly   222 EYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFS-----CGGGLMDWNDNDEPWE 281
              .:..||.||         :..:..:.|.:..:|..:...|.|     .||.....|      .
  Fly   408 --VLPNARART---------KVNYVYSAANYGGSGSSNGAGCNSGLNAVSGGKFGSVN------A 455

  Fly   282 QHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVASTQAS------EEEQQTSL 340
            ||....|..|          ...|.:|.||.....:||  |.:|:.....:      ..|..||:
  Fly   456 QHITSTSTLR----------AGVVGSKIVLGVSVRQSS--GELALRMVVLNIVEVDRNSESSTSV 508

  Fly   341 SSEE-AVS---GDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEK 389
            |::. :||   |.:..|.:|.......|. ...|.|...|.:.......|.||
  Fly   509 SNDSGSVSSGGGQLMKSSSPMVNVSAENN-ATVTQVNLESKDDDNKAMTPYEK 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595 30/73 (41%)
BIR 226..295 CDD:197595 15/73 (21%)
zf-C3HC4_3 387..432 CDD:290631 2/3 (67%)
BruceNP_001262460.1 BIR 251..321 CDD:279047 29/69 (42%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.