DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and mylipa

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_956277.1 Gene:mylipa / 335888 ZFINID:ZDB-GENE-030131-7831 Length:472 Species:Danio rerio


Alignment Length:346 Identity:68/346 - (19%)
Similarity:112/346 - (32%) Gaps:102/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 DICGA--NDSTLE--MREHAYAEGVIPMS------QLIQSIGMNAVN-------AAGSVTGTAAP 182
            ::||:  |.:|:.  :.:|...||:...|      ||:.|:....|.       .|..:.....|
Zfish   142 ELCGSEPNQTTINSIIAKHKALEGLSQASVEYQALQLVSSLEHYGVEWHWARDAEAQRLAIGVGP 206

  Fly   183 Q-----------------PRVTVATHAS-----TATQATGD---VQPETCRPSAASGNYFPQYPE 222
            :                 |.:.:||.:.     |.|:.:.|   :..:.....||||.|      
Zfish   207 EGIAICRDDFSLVNRISYPIIQIATQSGKSVYLTVTKESSDSVVLLFKLISNRAASGLY------ 265

  Fly   223 YAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWL 287
                                  ..:.|...||       ||.:....:|.....|......:|:|
Zfish   266 ----------------------RAITETHAFY-------RCDTVTNAVMMQYSRDFKGHLASLFL 301

  Fly   288 SQCRFVKLMKGQLYIDTV--AAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDV 350
            ::    .:..|:.|:..:  .:|.|....:....:.|.|.:.:..........|.|.|:..:.|.
Zfish   302 NE----NINLGKKYVFDIRRTSKEVYDYARRALYNAGIVDMMARPGERTPSNRSPSREQEGALDC 362

  Fly   351 APSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKC 415
            ..............|:.||.                   ||.:|...|.:.||.||||:|.|..|
Zfish   363 GGCQQSRLLQEKLQKLREAL-------------------LCMLCCEEEIDAAFCPCGHMVCCQNC 408

  Fly   416 ASSVTKCPLCRKPFTDVMRVY 436
            |:.:..||:||.....|..||
Zfish   409 AAQLQSCPVCRSEVEHVQHVY 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595 9/68 (13%)
zf-C3HC4_3 387..432 CDD:290631 18/44 (41%)
mylipaNP_956277.1 B41 3..190 CDD:214604 12/47 (26%)
FERM_N 5..68 CDD:286467
FERM_M 85..190 CDD:278785 12/47 (26%)
FERM_C_MYLIP_IDOL 185..295 CDD:270016 21/144 (15%)
zf-C3HC4_3 380..425 CDD:290631 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.