DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and BIRC5

DIOPT Version :10

Sequence 1:NP_524101.2 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001012271.1 Gene:BIRC5 / 332 HGNCID:593 Length:165 Species:Homo sapiens


Alignment Length:122 Identity:32/122 - (26%)
Similarity:47/122 - (38%) Gaps:36/122 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RLRTFEAWP--RNLKQKPHQLAEAGFFY---TGVGDRVRCFSCGGGLMDWNDNDEP--------- 279
            |:.||:.||  ......|.::|||||.:   ....|..:||.|...|..|..:|:|         
Human    18 RISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIGPGTVAYA 82

  Fly   280 --------------WEQHALWLSQCRFVKLMK-------GQ-LYIDTVAAKPVLAEE 314
                          .|:|....|.|.|:.:.|       |: |.:|...||..:|:|
Human    83 CNTSTLGGRGGRITREEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_524101.2 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595 24/93 (26%)
RING-HC_IAPs 388..427 CDD:438173
BIRC5NP_001012271.1 BIR 18..110 CDD:459891 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.