DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and BIRC5

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001012271.1 Gene:BIRC5 / 332 HGNCID:593 Length:165 Species:Homo sapiens


Alignment Length:122 Identity:32/122 - (26%)
Similarity:47/122 - (38%) Gaps:36/122 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RLRTFEAWP--RNLKQKPHQLAEAGFFY---TGVGDRVRCFSCGGGLMDWNDNDEP--------- 279
            |:.||:.||  ......|.::|||||.:   ....|..:||.|...|..|..:|:|         
Human    18 RISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIGPGTVAYA 82

  Fly   280 --------------WEQHALWLSQCRFVKLMK-------GQ-LYIDTVAAKPVLAEE 314
                          .|:|....|.|.|:.:.|       |: |.:|...||..:|:|
Human    83 CNTSTLGGRGGRITREEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595 24/93 (26%)
zf-C3HC4_3 387..432 CDD:290631
BIRC5NP_001012271.1 BIR 18..110 CDD:279047 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.