DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and XIAP

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001158.2 Gene:XIAP / 331 HGNCID:592 Length:497 Species:Homo sapiens


Alignment Length:495 Identity:131/495 - (26%)
Similarity:184/495 - (37%) Gaps:182/495 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPSYGPIAFDQVDNNTNATQLFKN----NINKT---RMNDLNREETRLKTFTDWPLDW--LDKRQ 63
            |.|....|.|: .:.|:|..|.:.    :|:.|   |...:..||.|||:|.:|| |:  |..|:
Human   121 LGSRDHFALDR-PSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWP-DYAHLTPRE 183

  Fly    64 LAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTN-NVPINAEALDR 127
            ||..|:|:|..||:|:||.||.::..||..|:...||:|..|||..:..|..| ....:|.:.||
Human   184 LASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDR 248

  Fly   128 ILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHA 192
            ..|                                     |:.|                     
Human   249 NFP-------------------------------------NSTN--------------------- 255

  Fly   193 STATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGV 257
                                    .|:.|..|...||:.||..|..::.::  |||.|||:..|.
Human   256 ------------------------LPRNPSMADYEARIFTFGTWIYSVNKE--QLARAGFYALGE 294

  Fly   258 GDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYI-------------------- 302
            ||:|:||.|||||.||..:::||||||.|...|:::...|||.||                    
Human   295 GDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKT 359

  Fly   303 --------DTVAAKPVLAEE-------------KEESSSIGG-------VAVA------STQASE 333
                    ||:...|::.|.             .||...|.|       |.||      .....:
Human   360 PSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQD 424

  Fly   334 EEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAE 398
            |..||||..|.:....:                                ..:.||||||||....
Human   425 ESSQTSLQKEISTEEQL--------------------------------RRLQEEKLCKICMDRN 457

  Fly   399 YNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS 438
            ....|:||||:|.|.:||.:|.|||:|....|...:::.|
Human   458 IAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595 32/69 (46%)
BIR 226..295 CDD:197595 32/68 (47%)
zf-C3HC4_3 387..432 CDD:290631 23/44 (52%)
XIAPNP_001158.2 BIR 1 26..93
BIR 28..95 CDD:237989
Interaction with caspase-7 141..149 0/7 (0%)
BIR 162..232 CDD:197595 32/70 (46%)
BIR 2 163..230 32/67 (48%)
BIR 265..331 CDD:197595 32/67 (48%)
BIR 3 265..330 32/66 (48%)
UBA_BIRC4_8 370..419 CDD:270578 9/48 (19%)
RING-HC_BIRC4_8 436..497 CDD:319628 23/92 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 1 1.000 - - FOG0000512
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100552
Panther 1 1.100 - - O PTHR10044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X559
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.