DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and Birc7

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001292139.1 Gene:Birc7 / 296468 RGDID:1562883 Length:285 Species:Rattus norvegicus


Alignment Length:361 Identity:94/361 - (26%)
Similarity:142/361 - (39%) Gaps:104/361 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLEM 146
            |||.|:...|:.:.|..|..|  |:||.       |..:..:.||.       .|.|      ::
  Rat    25 FCGPELSHREESNGPTQEQHR--PHCPC-------NRVLGQDCLDG-------QILG------QL 67

  Fly   147 REHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSA 211
            |         |:|:..:|.|...|..                                       
  Rat    68 R---------PLSEEEESSGATFVGE--------------------------------------- 84

  Fly   212 ASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDN 276
                  |.:||...|..||.:|..||.....:|..||.||||:||..|:||||.|.|||..|...
  Rat    85 ------PAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFFHTGQQDKVRCFFCYGGLQSWERG 143

  Fly   277 DEPWEQHALWLSQCRFVKLMKGQLYIDTVAA-KPVLA---EEKEESSSIGGVAVASTQASEEEQQ 337
            |:||.:||.|..:|:|:...||:.:::.:.| .|:|.   :.:|:..::.....|.|..|.|..:
  Rat   144 DDPWTEHARWFPRCQFLLRSKGRDFVERIQAYTPLLGSWEQREEQEDTVSATPSAPTHGSPELLR 208

  Fly   338 TSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTA 402
               |..|..|.|.:...|.....::                    ..:.||:.||:|.....:..
  Rat   209 ---SRRETQSEDASEPGAEDVQEQL--------------------RQLQEERRCKVCLDRAVSVV 250

  Fly   403 FLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS 438
            |:||||.| |.:||.::..||:||.|..:.:|.:.|
  Rat   251 FVPCGHFV-CTECAPNLRLCPICRVPICNCVRTFLS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595 11/29 (38%)
BIR 226..295 CDD:197595 33/68 (49%)
zf-C3HC4_3 387..432 CDD:290631 19/44 (43%)
Birc7NP_001292139.1 BIR 94..161 CDD:237989 32/66 (48%)
NTP-PPase 194..>236 CDD:302582 9/64 (14%)
zf-C3HC4_3 235..276 CDD:290631 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8204
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 1 1.000 - - FOG0000512
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100552
Panther 1 1.100 - - LDO PTHR10044
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.