DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and exc-14

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_504354.1 Gene:exc-14 / 178892 WormBaseID:WBGene00019649 Length:400 Species:Caenorhabditis elegans


Alignment Length:184 Identity:37/184 - (20%)
Similarity:67/184 - (36%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 KPVLAEEK-EESSSIGGVAVASTQASEE--------EQQTSLSSE-EAVSGDVAPSVAPTAATRI 362
            |.:.:||| .:...|..:....|....|        ::||:::.. |..|..:.|.|.....|:.
 Worm   216 KKIYSEEKARKDEEILNLQKQKTDVEMELERKSNLLDEQTNVTKRMEEKSYQLKPLVLLDELTKK 280

  Fly   363 FNKIVEATAVATPSTNS-------------SGSTSIPEEKL------------------------ 390
            .:::|:.:....|:.|:             ...|::.|.||                        
 Worm   281 HSQLVDLSTEFLPNINAVKMLYKELFESFPQLETNVHESKLSMERRVEEVEEQLRSRNRDFQRLQ 345

  Fly   391 ------CKICYGAEYNTAFLPCGHVVACAKC--ASSVTKCPLCRKPFTDVMRVY 436
                  |.||...:.:..|:||.|::.|:.|  ||...:||.||....:.:.|:
 Worm   346 EKLVAECCICLATKPSIVFMPCRHLITCSGCYDASDFRECPTCRSTIENSITVF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595
BIR 226..295 CDD:197595
zf-C3HC4_3 387..432 CDD:290631 18/76 (24%)
exc-14NP_504354.1 Smc <112..>272 CDD:224117 12/55 (22%)
zf-C3HC4_3 351..393 CDD:372816 15/41 (37%)
RING-HC finger (C3HC4-type) 352..388 CDD:319361 13/35 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D547697at33208
OrthoFinder 1 1.000 - - FOG0000512
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.