DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and Birc5

DIOPT Version :10

Sequence 1:NP_524101.2 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_033819.1 Gene:Birc5 / 11799 MGIID:1203517 Length:140 Species:Mus musculus


Alignment Length:100 Identity:29/100 - (28%)
Similarity:44/100 - (44%) Gaps:32/100 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RLKTFTDWPLDWLD-----KRQLAQTGMYFTHA-----GDKVKCFFCGVEIGCWEQEDQPVPEHQ 101
            |:.||.:||  :|:     ..::|:.|  |.|.     .|..:||||..|:..||.:|.|:.||:
Mouse    18 RIATFKNWP--FLEDCACTPERMAEAG--FIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHR 78

  Fly   102 RWSPNCPLL------------------RRRTTNNV 118
            :.||.|..|                  |:|..|.:
Mouse    79 KHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKI 113

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_524101.2 BIR 44..112 CDD:197595 26/92 (28%)
BIR 226..295 CDD:197595
RING-HC_IAPs 388..427 CDD:438173
Birc5NP_033819.1 BIR 18..88 CDD:459891 25/73 (34%)
BIR 18..88 25/73 (34%)