DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap1 and LOC101733194

DIOPT Version :9

Sequence 1:NP_001261916.1 Gene:Diap1 / 39753 FlyBaseID:FBgn0260635 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_031747885.1 Gene:LOC101733194 / 101733194 -ID:- Length:1363 Species:Xenopus tropicalis


Alignment Length:397 Identity:95/397 - (23%)
Similarity:155/397 - (39%) Gaps:89/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTD----WPLDWLDKRQLAQTGMYFTH 73
            |:...:.::...|.....:|..:..:.|:|.|.:||:|:..    :|:  .::|:|||.|.|:..
 Frog   355 PMPIKEGESGIPARYSGSHNPGEKPLGDMNNEYSRLETYRGHSQYFPM--ANQRRLAQAGFYYVG 417

  Fly    74 AGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNN----------VPINAEALDRI 128
            .||:|:||.||.|:..||:.|.|:..||...|:||.:::.....          ..|..|.....
 Frog   418 PGDRVRCFSCGGELEKWERWDVPLTRHQHSFPHCPYMQKLRDEGDGKENQSKVCAGIIKEGESGT 482

  Fly   129 LPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAV--NAAGSVTG---TAAPQPRVTV 188
            ..|:|      :.|.||.:...|........:..:..|.:.:  |..|....   ...|:.||  
 Frog   483 TVPLS------SSSNLEEKPCGYMSDEYSRLESYRGHGQHFIYWNQQGLAKAGFYYVGPKDRV-- 539

  Fly   189 ATHASTATQATGDVQ---------------PETC--------------RPSAASGNYFPQYP--- 221
                 ......|:::               |..|              ......|...|..|   
 Frog   540 -----RCYSCGGELENWMFWYVPPTQDQRSPSDCLHLHELFLSTTFMVGKQVILGMLDPSIPLLR 599

  Fly   222 ---EYAIETARLRTFEAWPRNLK-QKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQ 282
               |.:....|:.:::...::.. |...:||.|||:|.|.|||||||||||.:.:|...|.|..:
 Frog   600 PLGEVSEICIRIESYKVAKKHFPYQTSDELAWAGFYYVGPGDRVRCFSCGGEVDNWEPGDVPLTR 664

  Fly   283 HALWLSQCRFVKLMK-----------GQLYIDT-VAAKPVLAEEKEESSSIGGVAVASTQASEEE 335
            |.|....|.:|:.:.           |..::|| :..|..|.:..:|.|.|     .|.||::|.
 Frog   665 HQLSFPHCSYVQGLSIRHSYFMEEGVGPGFLDTNILGKKALGDMSDEYSRI-----QSYQAAKEH 724

  Fly   336 --QQTSL 340
              .||.:
 Frog   725 FPNQTPI 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap1NP_001261916.1 BIR 44..112 CDD:197595 28/71 (39%)
BIR 226..295 CDD:197595 27/69 (39%)
zf-C3HC4_3 387..432 CDD:290631
LOC101733194XP_031747885.1 BIR 67..122 CDD:395528
BIR 157..226 CDD:237989
BIR 272..338 CDD:237989
BIR 389..456 CDD:237989 27/68 (40%)
BIR 506..>551 CDD:412125 7/51 (14%)
BIR 610..677 CDD:237989 27/66 (41%)
BIR 714..781 CDD:237989 7/23 (30%)
FIIND 1017..1265 CDD:404443
CARD_ASC_NALP1 1278..1360 CDD:260039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D547697at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.