DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and AT4G38690

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_195581.1 Gene:AT4G38690 / 830025 AraportID:AT4G38690 Length:318 Species:Arabidopsis thaliana


Alignment Length:292 Identity:62/292 - (21%)
Similarity:120/292 - (41%) Gaps:75/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KKDSSDQPATQYLKGKCLPHYVASYNGTELLTVDCLKIQPNWMGQIKDINRMALKDIFLPGTHAS 167
            |..|:::.|...|:..|    ...:.|.:.:..|    :.|||..:.. .::.:..|..||||.|
plant    13 KAISTEKKALTDLEKSC----GCEFPGCDYMPSD----RKNWMAGVGP-EKLHINKIVWPGTHDS 68

  Fly   168 AAVLGSSSKSNSI----LVRDYLVAQQLDVWSQLVFGIRYLDLSIGYKNMNTENDADNFWIANEN 228
            |        :|.|    :.|.:...|.|.:::|||.|.|.||:.:          .::..:.:..
plant    69 A--------TNKIGIRFVSRPFAKCQSLSIYNQLVAGTRVLDIRV----------QEDRRVCHGI 115

  Fly   229 MLITPLLTVLRDVRQFVKRS-GEVVVLDFSSFPIGFYKHPEIYSSLFRLIRQELGDETYRRNVGK 292
            :....:..||.|:::|:..: .|:|:|:..: ..|....||....|.    ::||:..    :.:
plant   116 LKTYSVDVVLADLKRFLSETESEIVILEIRT-EFGHEDPPEFDKYLV----EQLGEHL----IHQ 171

  Fly   293 DENCANRNFSEILLQKRHLVILFPTQ-----------------------ELPYPDRESNMLCPPW 334
            |::..::..:| ||.||.:.:..|.:                       :||....|||:.....
plant   172 DDHVFSKTVAE-LLPKRVICVWKPRKSPQPKHGDPLWSAGYLKDNWIDTDLPSTKFESNIKHLSQ 235

  Fly   335 QRFSTS---FMNISQTLDYMRLLFSRKPDSPV 363
            |:.:||   |..:..|:       :.:||:|:
plant   236 QQPATSRKFFYRVENTV-------TPQPDNPI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 52/247 (21%)
AT4G38690NP_195581.1 PI-PLCXDc_plant 33..313 CDD:176556 57/268 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2671
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.