DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and AT4G34930

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_195219.1 Gene:AT4G34930 / 829645 AraportID:AT4G34930 Length:391 Species:Arabidopsis thaliana


Alignment Length:328 Identity:73/328 - (22%)
Similarity:130/328 - (39%) Gaps:106/328 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NWMGQIKDINRMALKDIFLPGTHASAAVLGSSSKSNSI---LVRDYL-VAQQLDVWSQLVFGIRY 203
            |||..: .::::.|..|..||||.||        :|.|   ||..:| ..|.|.::.|||.|.|.
plant   112 NWMAHL-SVDKLTLNKIVWPGTHDSA--------TNGIGDPLVTRWLGECQTLSIFDQLVLGTRV 167

  Fly   204 LDLSIGYKNMNTENDADNFWIANENMLITPLLTVLRDVRQFVKRS-GEVVVLDFSSFPIGFYKHP 267
            ||:     ....:....:..:::.|:.:     ||.||.:||..: .|:::|:            
plant   168 LDI-----RFQEDRCVCHGALSSYNVDV-----VLNDVIRFVSETQSEIIILE------------ 210

  Fly   268 EIYSSLFRLIRQELGD------ETYRRN------VGKDENCANRNFSEILLQKRHLVILFPTQEL 320
                     ||.|.|.      |||..:      :.:|:|..|:..||||  .:.::.::..:|.
plant   211 ---------IRTEFGKKDPFEFETYLVDKLGQFLIHQDDNLFNKPVSEIL--PKRVICIWKPRES 264

  Fly   321 PYPDR----------ESNMLCP--PWQRFSTSFMNISQTLDYMRLLFSRK------------PDS 361
            |.|.|          :.|.:..  ||.:|.::..::|:    .:.:.|||            .|:
plant   265 PKPSRGGILWNSDYLKDNWIDTDLPWTKFQSNLKHLSE----QQPISSRKFFYRVENTVTPQADN 325

  Fly   362 PVRNVGWIFTAVRSMEQTLNAHQLQTAKERAAVLNPKINKWLKGPWGYNANVVAMDYFSNTNIVD 426
            |   |.|    |:.:...:..|......:.|:          || :|....:::.|:... :.||
plant   326 P---VVW----VKQVTDRIRKHARLFISQCAS----------KG-YGDKLQILSTDFIEG-DFVD 371

  Fly   427 LAI 429
            ..:
plant   372 ACV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 70/323 (22%)
AT4G34930NP_195219.1 PI-PLCc_GDPD_SF 100..380 CDD:301322 73/328 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4634
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2671
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.