DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and AT4G34920

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_195218.1 Gene:AT4G34920 / 829644 AraportID:AT4G34920 Length:318 Species:Arabidopsis thaliana


Alignment Length:297 Identity:67/297 - (22%)
Similarity:111/297 - (37%) Gaps:99/297 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KKDSSDQPATQYLKGKCLPHYVASYNGTELLTVDCLKIQPNWMGQIKDINRMALKDIFLPGTHAS 167
            |.|.|..|...|....                      :.|||..: .:.::.|..|..||||.|
plant    27 KSDGSQFPGDDYRPSD----------------------RKNWMAGL-TLEKLTLNKIVWPGTHDS 68

  Fly   168 AAVLGSSSKSNSI----LVRDYLVAQQLDVWSQLVFGIRYLDLSIGYKNMNTENDADNFWIANEN 228
            |        :|.|    :.|.....|.|.::.|||.|.|.||:.                :..:.
plant    69 A--------TNDIGIPLISRPLAECQSLSIYEQLVLGTRVLDIR----------------VQEDR 109

  Fly   229 MLITPLLT------VLRDVRQFVKRS-GEVVVLDF-SSF----PIGFYKHPEIYSSLFRLIRQEL 281
            .:...:||      |:.||.:|:..: .|:|:|:. :.|    |.||    |.|          |
plant   110 QICHGILTSYEIDVVIDDVIRFLSETHSEIVILEIRTEFGHKDPPGF----ETY----------L 160

  Fly   282 GDETYRRNVGKDENCANRNFSEILLQKRHLVILFPTQELPYPDR----------ESNMLCP--PW 334
            .|:..:..:.:|::..|:..||||  .:.::.::..:|.|.|.|          :.|.:..  ||
plant   161 ADKLGQFLIHQDDSLFNKPVSEIL--PKRVICIWKPRESPKPSRGGILWNSDYLKDNWIDTDLPW 223

  Fly   335 QRFSTSFMNIS-QTLDYMRLLFSR-------KPDSPV 363
            .:|.::..::| |.....|..|.|       :.|:||
plant   224 TKFQSNLKHLSEQQPTSSRKFFYRVENTVTPQADNPV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 59/252 (23%)
AT4G34920NP_195218.1 PI-PLCc_GDPD_SF 33..313 CDD:387364 64/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4634
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2671
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.