DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and plcxd2

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_688423.2 Gene:plcxd2 / 559936 ZFINID:ZDB-GENE-091204-217 Length:320 Species:Danio rerio


Alignment Length:396 Identity:77/396 - (19%)
Similarity:132/396 - (33%) Gaps:168/396 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LKIQP-------NWMGQI-KDINRMALKDIFLPGTHAS-------AAVLGSSSKS---NSILVRD 184
            :|.:|       :|||.: ..:..|.||.:.:||:|.|       .|.:|...|:   :...:..
Zfish     1 MKTRPTGNTSNADWMGSLCPALTSMPLKHLAVPGSHDSFSFWVDEQAPVGPDQKAYVKHLAAIFR 65

  Fly   185 YLVAQQLDVWS---------QLVFGIRYLDLSI------------------GYKNMNTENDADNF 222
            :|..:.:..||         ||..||||.||.:                  |:|..:..||.:||
Zfish    66 FLAKKVMKKWSMTQNLTFREQLEGGIRYFDLRVSSKPGEAGHEIYFIHGLFGHKVRDGLNDINNF 130

  Fly   223 WIANENMLITPLLTVLRDVRQFVKRSGEVVVLDFS-SFPIGFYKHPEIYSSLFRLIRQELGDETY 286
            ...::.                     |||.|||: .:.:|    .|.:..|.::::...|.:..
Zfish   131 LNIHKK---------------------EVVFLDFNHHYAMG----EEHHRYLIKMLQDVFGHKLC 170

  Fly   287 RRNVGKDENCANRNFSEILLQKRHLVILFPTQELPYPDRESNMLCP----------PWQRFSTSF 341
            |.:|.::   ...|:   |.:.|:.|::|    ..:|..|.   ||          ||       
Zfish   171 RIDVVEE---ITLNY---LWENRYQVLVF----YHHPSAEG---CPVMWPGSKIPAPW------- 215

  Fly   342 MNISQTLDYMRLLFSRKPDSPVRNVGWIFTAVRSMEQTLNAHQLQTAKERA---------AVLNP 397
               :.|.|..:|                   ::.:|.||.        |||         |:|.|
Zfish   216 ---ANTTDTTKL-------------------IQFLETTLG--------ERAKYGSFHVSQAILTP 250

  Fly   398 KINKWLKG-------------------------PWGYNANVVAMDYFSNTNIVDLAIQVNAHKAF 437
            ::....:|                         |.....|::..|:   ..:||.|..|......
Zfish   251 RVKTIARGLVQGLRNYLVERNLPTIMTWVEAQKPGKDGVNIITSDF---VELVDFANTVIKLNTL 312

  Fly   438 VMANRD 443
            ::.:||
Zfish   313 LIKDRD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 70/369 (19%)
plcxd2XP_688423.2 PI-PLCXD1c 18..310 CDD:176555 70/369 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.