DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and zgc:112023

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001017673.1 Gene:zgc:112023 / 550368 ZFINID:ZDB-GENE-050417-162 Length:309 Species:Danio rerio


Alignment Length:354 Identity:80/354 - (22%)
Similarity:134/354 - (37%) Gaps:102/354 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DCLKIQPNWMGQIK----DINRMALKDIFLPGTHASAAVL--GSSSKSNS-------------IL 181
            ||.:   :||.::.    ||   .|.::.:||:|.|....  ..||.|||             .:
Zfish     5 DCYE---DWMSKMPSHMWDI---PLWNLAIPGSHDSMTYCLDKQSSVSNSTPRVVQVLDKYFPCI 63

  Fly   182 VR----DYLVAQQLDVWSQLVFGIRYLDLSIGYKNMNTENDADN-FWIANENMLITPLLT----- 236
            ||    .:...|:..:.:||..|||:|||.|.:|    ..|.|. |:.|:.   :..|||     
Zfish    64 VRPCIMKWATTQEGAISNQLDLGIRFLDLRIAHK----IKDPDEVFYFAHG---VYSLLTVKEAL 121

  Fly   237 --VLRDVRQFVKRSGEVVVLDFSSFP-IGFYKHPEIYSSLFRLIRQELGDETYRRNVGKDENCAN 298
              |:|.:.|.:|   |||::..|:|. :...:|.::...|.....:::..::...::   :.|.|
Zfish   122 TEVVRWLDQHIK---EVVIIALSNFEGMNLDQHKDLIQFLIATFNKKICPKSVTPSL---QECWN 180

  Fly   299 RNFSEILLQKRHLVILFPTQELPYPDRESN------MLCPPWQRFSTSFMNISQTLDYMRLLFSR 357
            .::..|               |.|.|..|.      ..||.|      :.|.|..    .|:.|.
Zfish   181 HSYQVI---------------LSYDDESSTGYVELWPQCPYW------WANKSDP----NLVISY 220

  Fly   358 KPDSPVRNVG---WIFTAVRSMEQTLN------AHQLQTAKERAAVLNPKINKWLK----GPWGY 409
            ..|.  :|.|   ..|.|..::.:...      ...||:...|:..|   :.||:|    |....
Zfish   221 LEDQ--KNEGRPSQFFAAGLNLTEDARYVLCHPCQSLQSMTRRSYSL---LMKWVKQQRPGSGQA 280

  Fly   410 NANVVAMDYFS--NTNIVDLAIQVNAHKA 436
            ..|::..|:..  .:....|.|.:|..:|
Zfish   281 CLNIICADFVGIFGSESTQLVIGLNQIEA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 75/339 (22%)
zgc:112023NP_001017673.1 PI-PLCXD1c 14..305 CDD:176555 74/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243732at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.