DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and plcxd3

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001014322.1 Gene:plcxd3 / 541487 ZFINID:ZDB-GENE-050327-10 Length:322 Species:Danio rerio


Alignment Length:359 Identity:81/359 - (22%)
Similarity:134/359 - (37%) Gaps:98/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VASYNG-TELLTVDCLKIQPNWMGQIKD-INRMALKDIFLPGTHAS------------------- 167
            :||..| :||...|       ||..:.| ::.:.|.::.:||:|.|                   
Zfish     1 MASSQGKSELRYAD-------WMSSLPDTLHGIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETV 58

  Fly   168 ---AAVLGSSSKSNSILVRDYLVAQQLDVWSQLVFGIRYLDLSIGYKNMNTENDADNFWIANENM 229
               .:|.|:.:|.   |:|.:|..|.::..|||..|||:.||.|..|    ..|.||.......:
Zfish    59 QNFVSVFGTVAKK---LMRKWLATQTMNFTSQLEAGIRFFDLRISTK----PRDPDNELYFAHGL 116

  Fly   230 LITPLLTVLRDVRQFV-KRSGEVVVLDFSSFPIGFYKHPEI-YSSLFRLIRQELGDETYRRNVGK 292
            ....:...|..:..|: ..:.|||.|||:.    ||....: :..|.:::|...||..       
Zfish   117 FSATVREGLEQISTFLASHAREVVFLDFNH----FYGVQNLHHEKLVQMLRTVFGDRL------- 170

  Fly   293 DENC----ANRNFSEILLQKRHLVILF----PTQELPY--PDRESNMLCPPWQRFSTSFMNISQT 347
               |    |.....:.|.:|.:.|::|    ...|:|:  |   ..|:..||          :.|
Zfish   171 ---CPVVFAQEVSLKYLWEKEYQVLVFYHNPMALEVPFLWP---GQMMPAPW----------ANT 219

  Fly   348 LDYMRL-LFSRKPDSPVRNVGWIF-----------TAVRSMEQTLNAHQLQTAKERAAVLNPKIN 400
            .|..:| ||.:......|..|..|           |.::.:...|.    :|..|||.   |.:.
Zfish   220 TDPEKLILFLQASVKDRRRKGTFFVSQVVLTPKASTVMKGVTSGLR----ETITERAL---PSMM 277

  Fly   401 KWLKG--PWGYNANVVAMDYFSNTNIVDLAIQVN 432
            :|::.  |.....|::..|:......:...|.:|
Zfish   278 QWIRSQRPGESGVNIITADFVELGEFISAVITLN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 73/334 (22%)
plcxd3NP_001014322.1 PI-PLCXD1c 19..311 CDD:176555 72/332 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.