DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and Plcxd2

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001127952.1 Gene:Plcxd2 / 433022 MGIID:3647874 Length:340 Species:Mus musculus


Alignment Length:368 Identity:72/368 - (19%)
Similarity:134/368 - (36%) Gaps:114/368 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CLPHYVASYNGTELLTVDCLKIQPNWMGQI-KDINRMALKDIFLPGTHAS-------AAVLGSSS 175
            |.|:...:...:|:...|       ||..: ..::.:.|.::.:||:|.|       .:.:|...
Mouse    17 CSPNPSGTKTASEVCNAD-------WMASLPAHLHNVPLSNLAIPGSHDSFSYWVDEKSPVGPDQ 74

  Fly   176 KSNSI-LVRDYLVAQQLDVWS---------QLVFGIRYLDLSIGYKNMNTENDADNFWIANENML 230
            ....| |.|..||.:.:..||         ||..||||.||.:..|..:|  |.:.::|  ..:.
Mouse    75 TQAVIRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDT--DQEIYFI--HGLF 135

  Fly   231 ITPLLTVLRDVRQFV-KRSGEVVVLDFSSFPIGFYKHPEIYSSLFRL-IRQELGDETYRRNVGKD 293
            ...:...|.::..|: :...|::.|||:.    ||...|.:.....| |::..|::..       
Mouse   136 GIKVWDGLMEIDAFLTQHPQEIIFLDFNH----FYAMDESHHKCLVLRIQEAFGNKLC------- 189

  Fly   294 ENCANRNFS-EILLQKRHLVILFPTQELPYPDRESNMLCPPWQRFSTSFMNISQTLDYMRLLFSR 357
            ..|:..:.: ..|.:|::.|::|             ..||.:::             |..|...:
Mouse   190 PACSVESMTLRSLWEKKYQVLIF-------------YHCPFYKQ-------------YPFLWPGK 228

  Fly   358 KPDSPVRNVGWIFTAVRSMEQTLNAHQLQTAKERA---------AVLNPKIN------------- 400
            |..:|..|...:...:..:|.||:        |||         |:|.|::.             
Mouse   229 KIPAPWANTTSVQKLILFLETTLS--------ERAPRGAFHVSQAILTPRVKTIARGLVGGLKNT 285

  Fly   401 ----------KWLK--GPWGYNANVVAMDYFSNTNIVDLAIQV 431
                      .|:|  .|.....|::..|:   .:::|.|..|
Mouse   286 LVHRNLPAILDWVKTQKPGAMGVNIITSDF---VDLIDFATTV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 66/339 (19%)
Plcxd2NP_001127952.1 PI-PLCXD1c 39..329 CDD:176555 66/339 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.