DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and Plcxd1

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_997162.2 Gene:Plcxd1 / 403178 MGIID:2685422 Length:357 Species:Mus musculus


Alignment Length:345 Identity:72/345 - (20%)
Similarity:121/345 - (35%) Gaps:100/345 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QPNWMGQI-KDINRMALKDIFLPGTHASAAVL----GSSSKSNSIL---------------VRDY 185
            |.:||.|: ..:..:.|..:.:||:|.:....    ...|:::|.|               |..:
Mouse    54 QADWMSQLCPQLWDVPLHHLSIPGSHDTMTYCLNRKSRISRASSWLLHLLGRVVPFITGPVVMKW 118

  Fly   186 LVAQQLDVWSQLVFGIRYLDLSIGYKNMNTENDADNFWIANENMLITPLLT--VLRDVRQFVK-R 247
            .|.|.|||..||..|:|||||.|.:.   .|....|....  :|:.|..|.  .|.::.:::: .
Mouse   119 SVTQTLDVTQQLDAGVRYLDLRIAHA---PEGSTRNLCFV--HMMYTKALVEDTLTEIAEWLQSH 178

  Fly   248 SGEVVVLDFSSFPIGFYKHPEIYSSLFRLIRQELGDETYRRNVGKDENCANRNFSEILLQKRHLV 312
            ..|||:|...:|. |.  ..|::..|...|....||                             
Mouse   179 PREVVILACRNFE-GM--TCELHDYLAGCIVNIFGD----------------------------- 211

  Fly   313 ILFPTQELP---------------YPDRES----NMLCPPWQRFSTSFMNISQTLDYMRLLFSRK 358
            :|.|:.|:|               |.|..:    :.|   |......:.|..:|...:|.|.:.|
Mouse   212 MLCPSGEVPTLRQLWAREQQVIVSYEDEATVSRYDQL---WPAIPYWWGNAVKTDVLLRFLETMK 273

  Fly   359 ----PDSPVRNVGWIFTAVRSMEQTL---NAHQLQTAKERAAVLNPKINKWL----KGPWGYNAN 412
                ||.       :|.|..::.:.|   ..|.:.:.:|......|.:.:|:    .|......|
Mouse   274 GQGRPDG-------LFVAGINITENLCYILLHPVDSLEEMTRRSLPLMTEWVCAQQPGQSPQCTN 331

  Fly   413 VVAMDYFSNTNIVDLAIQVN 432
            ::|.|:......|...|.:|
Mouse   332 IIAGDFVDADGFVSKVISLN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 68/338 (20%)
Plcxd1NP_997162.2 PI-PLCXD1c 61..351 CDD:176555 67/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.