DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and zgc:64065

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_958491.1 Gene:zgc:64065 / 393379 ZFINID:ZDB-GENE-040426-1355 Length:304 Species:Danio rerio


Alignment Length:330 Identity:72/330 - (21%)
Similarity:125/330 - (37%) Gaps:73/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NWMGQIKD-INRMALKDIFLPGTH-ASAAVLGSSS---KSNSI-------------LVRDYLVAQ 189
            :||.::.: ...:.|..|.:||:| |.|..|...|   :.:|:             :|:::.:.|
Zfish     9 DWMSKLNETFTTVPLCYIAIPGSHDAMAYSLDMDSPLLEPDSLITMDLICCGCCRSIVKNWSITQ 73

  Fly   190 QLDVWSQLVFGIRYLDLSIGYKNMNTENDADNFWIANENMLITPLLTVLRDVRQFV-KRSGEVVV 253
            ...:..||..|:||.||.:..|    ...:|.|:.......|| :...:.:|..:: |.|.|||:
Zfish    74 DKTISEQLDAGMRYFDLRVAGK----PGSSDFFFYHGLYTTIT-VKEAMEEVDTWLGKHSKEVVI 133

  Fly   254 LDFSSFPIGFYKHPEIYSSLFRLIRQELGDE------TYRRNVGKDENCANRNFSEI--LLQKRH 310
            |.||.|                   :|:..|      |:.::..|.:.|.:.....:  ...|.:
Zfish   134 LAFSHF-------------------KEMSTEQHTKLMTFLKDHFKAKLCPDDGMPSLKDCWDKAY 179

  Fly   311 LVILFPTQELPYPDRESNMLCPPWQRFSTSFMNISQTLDYMRLLFSRKPDSPVRNVGWIFTAVR- 374
            .||      |.|.||........|......:.|.|...:.:..|.::|...  |..|:....:. 
Zfish   180 QVI------LSYDDRNRKQDRVLWPGIKYWWANNSDPNEAILFLDNKKQSG--RPKGFFVAGLNL 236

  Fly   375 -----SMEQTLNAHQLQTAKERAAVLNPKINKWLK----GPWGYNANVVAMDYFSNTNIVDLAIQ 430
                 |:...|.|    :.||:.....|.:..|:|    |....:.|::|.|:|...:.....||
Zfish   237 TFYGCSIFSNLTA----SLKEKTVTAYPLLLDWVKKQRPGSDTQSINIIAGDFFDVNSFAQDIIQ 297

  Fly   431 VNAHK 435
            :|..|
Zfish   298 LNDAK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 69/323 (21%)
zgc:64065NP_958491.1 PI-PLCXD1c 14..299 CDD:176555 68/320 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243732at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.