DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and Plcxd2

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001127953.1 Gene:Plcxd2 / 363781 RGDID:1563504 Length:340 Species:Rattus norvegicus


Alignment Length:368 Identity:71/368 - (19%)
Similarity:135/368 - (36%) Gaps:114/368 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CLPHYVASYNGTELLTVDCLKIQPNWMGQI-KDINRMALKDIFLPGTHAS--------AAVLGSS 174
            |.|:...:...:|:...|       ||..: ..::.:.|.::.:||:|.|        :.|....
  Rat    17 CSPNPSGTKTASEVCNAD-------WMASLPPHLHNVPLSNLAIPGSHDSFSYWVDEKSPVGPDQ 74

  Fly   175 SKSNSILVRDYLVAQQLDVWS---------QLVFGIRYLDLSIGYKNMNTENDADNFWIANENML 230
            :::...|.|..||.:.:..||         ||..||||.||.:..|..:|  |.:.::|  ..:.
  Rat    75 TQAVKRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDT--DQEIYFI--HGLF 135

  Fly   231 ITPLLTVLRDVRQFV-KRSGEVVVLDFSSFPIGFYKHPEIYSSLFRL-IRQELGDETYRRNVGKD 293
            ...:...|.::..|: :...|::.|||:.    ||...|.:.....| |::..|::..       
  Rat   136 GIKVWDGLMEIDAFLTQHPQEIIFLDFNH----FYAMDEAHHKCLVLRIQEAFGNKLC------- 189

  Fly   294 ENCANRNFS-EILLQKRHLVILFPTQELPYPDRESNMLCPPWQRFSTSFMNISQTLDYMRLLFSR 357
            ..|:..:.: ..|.:|::.|::|             ..||.:::             |..|...:
  Rat   190 PACSVESMTLRTLWEKKYQVLIF-------------YHCPFYKQ-------------YPFLWPGK 228

  Fly   358 KPDSPVRNVGWIFTAVRSMEQTLNAHQLQTAKERA---------AVLNPKIN------------- 400
            |..:|..|...:...:..:|.||:        |||         |:|.|::.             
  Rat   229 KIPAPWANTTSVQKLILFLETTLS--------ERAPRGAFHVSQAILTPRVKTIARGLVGGLKNT 285

  Fly   401 ----------KWLK--GPWGYNANVVAMDYFSNTNIVDLAIQV 431
                      .|:|  .|.....|::..|:   .:::|.|..|
  Rat   286 LVHRNLPAILDWVKTQKPGAMGVNIITSDF---VDLIDFATTV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 65/339 (19%)
Plcxd2NP_001127953.1 PI-PLCXD1c 39..329 CDD:176555 65/339 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.